KEGG   Vigna radiata (mung bean): 106756410Help
Entry
106756410         CDS       T04126                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:vra00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106756410
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106756410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 106756410
NCBI-ProteinID: XP_014494319
UniProt: A0A1S3TKL3
LinkDB All DBs
Position
2
AA seq 204 aa AA seqDB search
MHLAMAANAVVAPSPFQPSSLLRSSFSGVSVKLTPQSLTFSRSRALTVFAATKKAVAVLK
GTSAVEGVATLTQEDDGPTTVTVRITGLTPGLHGFHLHEYGDTTNGCISTGAHFNPKKLT
HGAPEDEIRHAGDLGNIVANADGVAEVSIVDNQIPLSGPNSVVGRALVVHELEDDLGKGG
HELSLTTGNAGGRLACGVVGLTPA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcatctagcaatggcagccaacgctgtcgtcgctccgtcaccgttccaacccagctcg
cttctccggtcatcattctccggcgtctccgttaagctcactccccaatccctaaccttt
tcccgctcgagggccctcaccgtcttcgccgccaccaagaaggccgttgccgtcctcaag
ggaacctccgccgtcgaaggcgtagccaccctaacacaagaagacgatggcccaacaacg
gttactgttcgcattactggccttactccggggcttcatggttttcaccttcatgagtat
ggtgataccacaaatgggtgtatttcgacaggagcacattttaatcctaaaaaattgaca
catggtgctcctgaggatgaaatccgtcatgcgggtgacctgggaaacatagttgctaat
gcagatggggttgcagaggtttcaatcgtggataatcagataccactctctggccccaat
tcagtagttggaagagccttggtggttcatgagcttgaggatgatctcggaaaggggggt
catgaacttagtttgacaactggaaatgctggtggaagattagcatgtggtgtggttggt
ttgactccggcataa

DBGET integrated database retrieval system