KEGG   Vigna radiata (mung bean): 106762873Help
Entry
106762873         CDS       T04126                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00020  Citrate cycle (TCA cycle)
vra00190  Oxidative phosphorylation
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106762873
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106762873
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106762873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 106762873
NCBI-ProteinID: XP_014502464
UniProt: A0A1S3U912
LinkDB All DBs
Position
5
AA seq 279 aa AA seqDB search
MAATGLLKRAAQRVPSSPAFKLAFIRAHASEAQAQQVEPKARDTTSLKTFQIYRWNPENP
SKPELKDYQINLKECGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLAC
LTKIPSASTASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPVPGKEILQSK
RDREKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLDAI
NDEFKLYRCHTILNCARACPKGLNPGKQISHIKSLQPKA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggggttgctgaagagagcggcgcagcgggtgccgtcttcgccggcgttc
aagctggcattcatccgggcccacgcgtcggaggcccaggcccagcaggtggagccgaag
gcacgcgacacgacctccctgaagaccttccaaatctaccggtggaaccctgagaacccg
tcgaaaccggagctgaaggactaccagatcaacctgaaggagtgcgggcccatggtcctg
gacgcgctcatcaagataaaaaacgagatcgatcccaccctcaccttccgccgctcctgc
cgcgagggaatctgcggctcctgcgccatgaacattgacggctgcaacggcctcgcttgt
ctcaccaagattccgtccgcatcgacggcctccaccataacgccgttgccgcacatgttc
gtgatcaaggacctggtcgtggacatgaccaacttctacaaccagtacaagagcatcgag
ccctggctcaagcggaagaacccgccgccggtgccagggaaggagatcctgcagagcaag
agggaccgcgaaaagctcgacgggatgtacgagtgcattctgtgcgcctgctgtagcaca
tcctgccctagctactggtggaaccccgagtcatatctcggacccgctgccttgctccac
gctaacaggtggataagcgacagtcgtgatgagtacactaaagagagattggatgccatt
aatgacgaattcaagctctatcgttgccacaccatattgaactgtgctcgtgcctgccca
aaggggttgaacccaggaaagcaaatctcacatatcaagtcacttcagcctaaagcctaa

DBGET integrated database retrieval system