KEGG   Vigna radiata (mung bean): 106765582Help
Entry
106765582         CDS       T04126                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00020  Citrate cycle (TCA cycle)
vra00190  Oxidative phosphorylation
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106765582
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106765582
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106765582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 106765582
NCBI-ProteinID: XP_014505747
UniProt: A0A1S3UI92
LinkDB All DBs
Position
7
AA seq 620 aa AA seqDB search
MWRCVARANHQSLRSYASRFFSSGGNSSYNVVDHKYDAVVVGAGGAGLRAAIGLSEHGFN
TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREA
PKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYG
QAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAASTILATGGYGRAYFS
ATSAHTCTGDGNAMAARAGVPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGER
FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKERLPGISE
TAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAVVPGLMAAGETACA
SVHGANRLGANSLLDIVVFGRACANRVAEIRRPGDKQKPLEKDAGMKTIAWLDKLRNSNG
SLPTSKIRLDMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLEDRGLIWNSDLIE
TIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRP
VHMNTLDNEVESFPPKARVY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtggctcgtgcaaatcaccaatcactgagatcttacgcgtcaagattt
ttctctagtggtggaaactcctcctacaacgtggtcgatcacaagtacgatgcggttgtc
gtgggtgctgggggtgcagggttgagagccgccattggactttccgaacatggcttcaac
actgcttgcatcacgaagctcttcccaactcgttcgcacactgttgcagctcagggtggt
ataaatgctgcattgggaaatatgactgaagatgattggaggtggcacatgtacgacact
gtcaagggaagtgattggcttggggaccaagatgccatccaatatatgtgtagggaggca
ccaaaagcagtaattgaacttgaaaattatggactgccattttcaagaactgaagatgga
aaaatataccagcgtgcatttggtggtcagagcttgaactttggaaaaggtggtcaggca
tatcgttgtgcatgtgctgctgatcgaactggacatgctttgttgcacactctctacggc
caagctatgagacataatacccagttttttgtggaatattttgcactagatctattaatg
aacagtgatggtagttgccaaggagtgattgccttgaatatggaagatggaacattacat
cgtttccaagcagcttcaacaattttggccacggggggctatggtagagcttatttttct
gccacctcagcacatacatgtactggagatggcaatgccatggctgcacgggctggggtc
ccacttgaggatttagagtttgtgcaatttcaccctacaggcatatatggagcgggctgc
cttatcacggaaggttctcgtggtgaaggtgggattcttaggaacagtgagggtgagagg
tttatggaacgttatgctcctactgcaaaggatctcgcatcaagagatgtcgtttccaga
tcaatgactatggaaatccgggaaggccgtggtgtaggaccccataaagatcacatctat
ctacacctgaatcacttacccccagaagttctcaaggagagactacctggtatctctgaa
acagctgctatttttgctggtgtggatgttactaaggagcctattcctgttttgccaaca
gtgcattataacatgggtggtattccaacgaatcatcatggagaggtggttactatcaaa
ggtaatgatccagatgctgtagttcctggattaatggctgctggggaaacagcctgtgct
tcagttcatggtgccaacaggcttggtgcaaattcacttcttgacattgttgtttttggt
agagcttgtgcaaatagagttgcagaaatccgtagaccaggagataaacaaaagccttta
gagaaagatgctggtatgaaaacaattgcttggctggacaaattgagaaattcaaatgga
tcattgccaacttccaaaattcggttggatatgcaaagagtaatgcaaaacaatgctgct
gtgttccgtacccaagaaacattagaagaaggttgtcaattaattgataaaacatgggag
agcttccatgatgtcaagttggaggatcgaggtttgatatggaactctgacttgattgag
accattgagttggaaaatcttttgattaatgcctgcatcaccatgcactctgctgaagca
agaaaagagagtagaggtgctcatgcccgtgaggactttacgaaaagagacgatgaaaac
tggatgaaacacactttgggatattgggagaatgagaaggtccggttagattacaggcca
gtgcacatgaacacgttggacaatgaggtggaatcattccctcctaaagctcgtgtttat
taa

DBGET integrated database retrieval system