KEGG   Vigna radiata (mung bean): 106765767Help
Entry
106765767         CDS       T04126                                 

Definition
(RefSeq) zinc finger transcription factor YY1
Organism
vra  Vigna radiata (mung bean)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_aberr zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 106765767
NCBI-ProteinID: XP_014505982
UniProt: A0A1S3UIW5
LinkDB All DBs
Position
7
AA seq 372 aa AA seqDB search
MEIHYSSSYFERRPILKSKAPAVKWVKEWVPQDLVTTGGKCMLLKWVTEDTLKTLKEKTT
EPTMPEPEPEPTTEVLFLCSYDGCGKTFIDAGALRKHSHIHGERQYVCHYEGCGKKFLDS
SKLKRHFLIHTGERDFVCPHEGCGKAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHE
YKLKNHIASHHEKNASVDVTKYTTPPSEKQTKTAKSSGGAYGSASSDRPYACPYDGCEKA
YIHEYKLRLHLKREHPGLMPDENAEHAQANNVDNEMDEASDQDAYITKRSNGKIQKQSRP
KPSLKLPPSKIAKRKVSTPTITVNKNSWPVKDEPFDEEDSEETEEDRDNVEDGWRYTGGN
NEDDDEETEYED
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagattcactacagtagcagctacttcgaaagacgtcccattctcaagtccaaggct
cccgcagttaaatgggttaaagaatgggttccccaagatctcgtaacaactggaggaaaa
tgcatgctcttaaaatgggtaacagaggataccttgaagaccttgaaagaaaagacaaca
gaaccaacaatgcctgagccagaaccagagccaactactgaagtactttttctttgtagc
tatgatggatgtggaaagacattcatagatgctggtgcattgaggaagcattctcacatc
catggagagaggcaatatgtctgtcactacgaggggtgtggaaagaaatttctggatagc
tcaaaattgaaaagacattttctcattcatacaggggagagggattttgtgtgtcctcat
gaaggttgtggtaaggccttttccttggatttcaacttaaggtctcatatgaaaacacat
tcccaagagaactatcatatctgcccgtacccagattgtggaaagagatatgctcacgaa
tacaaactaaagaatcacattgcatctcatcatgaaaagaatgcatcagtggatgtgaca
aagtacactactccaccttcagagaagcaaacaaaaactgctaaatcgtctggaggggca
tatggttctgcatcatccgaccgtccctatgcatgtccatatgatgggtgtgaaaaggca
tatatccatgaatacaagcttagactgcatttgaagagggaacacccggggcttatgcct
gatgaaaatgctgagcatgctcaggctaataatgttgacaatgaaatggatgaagcaagt
gaccaagatgcctatatcacgaaacggtcaaatggtaaaattcagaaacagagtaggcct
aaaccaagtcttaagttgcctccttccaaaattgcaaaacgcaaagtgtccactcccact
ataactgtaaataaaaattcttggcccgtgaaagatgaaccttttgatgaagaagatagt
gaggaaacagaagaagatcgtgacaatgttgaagatggttggagatatactggaggaaac
aatgaagatgacgatgaagaaacagaatatgaagactga

DBGET integrated database retrieval system