KEGG   Vigna radiata (mung bean): 106772404Help
Entry
106772404         CDS       T04126                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00564  Glycerophospholipid metabolism
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106772404
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     106772404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA HI0933_like Pyr_redox_3 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 106772404
NCBI-ProteinID: XP_014514280
UniProt: A0A1S3V7G0
LinkDB All DBs
Position
8
AA seq 626 aa AA seqDB search
MTGLRRLGTAVGAAVAIAYGGSILISPPVSVSDGGSHLAAVREKIHDPFAAVPSREVQRS
ALIGAGAASPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIHGGV
RYLEKAVFKLDYGQLKLVFHALEERKQVIDNAPHLCQALPCMTPCFEWFEVLYYWIGLKM
YDLVAGARLLHLSRYYSAKESVELFPTLAKEGKGRSLRGTVVYYDGQMNDARLNVGLACT
AALAGAAVLNHAEVVSLLKDDAGERIIGARIRDNLTGKEFDTYAKVIVNAAGPFCDSVRK
MADKSARDLISPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNT
SITFLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMDPSAKNTESISRDHV
VFEDLPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLTPTNECVTNNLRIVGGEGWDPASF
TILSQQYVRMKVTYKGKVVPGVMDTAAAKHLSHAYGTLAERVASIAQNENLGKRLAHGYP
FLEAEVAYCARHEYCESAIDFISRRSRLAFLDTDAAGRALPRVIQILGSEHKWDKTRQKQ
EMQKAKEFLETFKSSKNAQFHDGKHN
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgactggcctcaggcgacttggcaccgccgtcggagccgccgtggccatcgcatacggc
ggctccatcctcatctcgcctcctgtatccgttagcgacgggggatcgcatctcgccgct
gtccgagagaagatccacgatccatttgctgccgtgccgtcgagagaggtccagcggtcg
gcgctcatcggcgcgggtgccgccagtcctctggatgttctcgttatcggcggtggcgcc
accggctccggcgtggcgttggacgccgtcactcgaggactccgcgttggcctcgtcgag
agagaggatttctcttccggaacttcctctcgctccaccaagctcattcatggaggtgtt
cgatacctagagaaagctgtctttaaacttgactatggccagctaaagctagtattccat
gcacttgaggaacgtaaacaggttattgacaatgcaccacacctatgccaagctttgcct
tgcatgacaccatgctttgagtggtttgaagtactgtactactggattggcttgaaaatg
tacgatttggtcgcaggagcacgattattacacttatcgagatattattcagcaaaggag
tctgttgaactttttcccactcttgcaaaggaggggaaaggtagaagtctgaggggcacg
gttgtttattatgatggacagatgaatgatgcacgtcttaatgttggactggcttgcact
gcagcattagctggtgctgcagttctgaatcatgcagaagttgtatctttactgaaggat
gatgctggtgaacggataattggtgcacgaattagggataatttaactggcaaagagttt
gatacatatgcaaaagtaattgtgaatgcggctgggcctttttgtgattctgtaaggaaa
atggctgacaaaagtgcacgtgacttgatttctccaagcagtggtgtacatattatactc
cctgattattattcccccgagggaatgggcttgattgttccgaaaactaaggatggacgt
gttgttttcatgctaccatggttgggaaggacagttgccggaactacagattctaatacc
agcattacctttcttccagaaccacatgaagacgaaatacaatttatattagatgccata
tctgattaccttaatgttaaagtccgccgcactgatgttctttctgcctggagtggcatt
cgtccattagccatggacccatcagctaaaaataccgagagtatctctagggatcatgtt
gtctttgaggatctccctggtttggtcaccattaccggtggcaagtggactacctataga
agcatggcagaagatgctgtcgatgcagctataaagtctgggaagttgacccccaccaat
gaatgtgtcaccaacaatctaaggattgttggtggtgaagggtgggatcctgcatctttt
accattctttctcagcagtatgtgcgcatgaaagtaacatacaagggtaaagttgttccc
ggtgtgatggacactgctgcagcaaagcacttgtctcatgcatatggaacattggctgaa
cgtgttgcttccattgctcagaatgaaaatttgggtaagcgacttgcccatggttaccct
tttttggaggctgaggtggcctactgtgctcgtcatgagtattgtgaatcagcaattgac
ttcatttcgaggaggtctcgtctagctttccttgacactgatgctgcaggacgggcctta
cctcgtgtcattcaaatattgggatctgagcacaaatgggacaagacaaggcagaaacaa
gagatgcagaaagctaaagaatttttggagacttttaaatcctccaaaaatgctcaattc
catgatgggaagcataattag

DBGET integrated database retrieval system