KEGG   Vigna radiata (mung bean): 106772727Help
Entry
106772727         CDS       T04126                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00020  Citrate cycle (TCA cycle)
vra00620  Pyruvate metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
vra01200  Carbon metabolism
Module
vra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106772727
   00020 Citrate cycle (TCA cycle)
    106772727
   00620 Pyruvate metabolism
    106772727
Enzymes [BR:vra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     106772727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 106772727
NCBI-ProteinID: XP_014514780
UniProt: A0A1S3V920
LinkDB All DBs
Position
8
AA seq 466 aa AA seqDB search
MASLPNTLSFSSSLSTTATLLPCRRFVAFPRRRFSVQAKIREIFMPALSSTMTEGKIVSW
IKSEGDKLSKGESVVVVESDKADMDVETFYDGILAAIVVADGETAPVGAAIGLLVDSPEE
VAEAKAKAAQSAPSPAAPSAAAPSAAALETTPPPPPPAKSVSDGPRKTVATPQAKKLAKQ
HKVDIATVVGSGPFGRITPADVEAAAGIAPSKSNVSPPVSPAPAAPTPAPKSAAGSAAPA
PIPGSSVVPFTTMQSAVAKNMVESLSVPTFRVGYPVTTDALDALYEKVKPKGVTMTAILA
KAAAMALVQHPVVNATCKDGKNFVYNSNINVAVAVAINGGLITPVLQDADKLDLYLLSQK
WKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVLAD
KDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPESLTL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcatccctccccaacaccctttccttctcctcctccctctccaccaccgccactctc
ctcccatgccgccgcttcgtcgcattcccccgccgccgcttctccgttcaagccaagatc
cgtgaaatcttcatgcctgccctcagctccaccatgaccgaaggcaaaatcgtctcctgg
atcaaatccgagggcgacaagctctccaagggtgaaagcgttgtcgtcgttgagtccgac
aaggccgacatggacgtagagaccttctacgacggcatactggccgccatcgtcgttgcc
gacggcgaaactgcccccgtcggagccgccattggccttctcgtcgattctcccgaagaa
gtcgccgaagccaaagccaaagccgcccaatctgctccttctcccgccgctccctccgcc
gccgctccctctgccgctgctctggagactactccgccacctcctcctccggcaaagtcc
gtttctgatgggccaaggaagaccgtggccacgcctcaggctaagaagctcgcaaagcag
cacaaggtggacattgcgacagtcgtgggatccggtccgtttggccggattactcctgca
gatgtggaggctgcggccggaatagctccgtcgaagagcaatgtgtctccgccggtgagt
cctgctccggcggcgccaactcctgcaccgaaatctgctgctggttctgctgcaccagct
cccattccgggttcgagtgttgttcctttcactacgatgcaatctgccgtggcgaagaac
atggtggagagtctatctgtgcctactttcagggttgggtaccctgtgactactgatgca
ttggatgctctttatgagaaggtgaaaccgaagggtgtgactatgacggctattttggct
aaggctgctgcgatggcacttgttcaacaccctgttgtcaatgccacctgcaaagacggt
aagaacttcgtctataacagtaacattaatgttgctgttgccgtagcaattaatggtggt
ttgattactcctgttctccaggatgcagataagttggacttgtatctgttgtcccaaaaa
tggaaggaactagtggaaaaagctcgtgcaaagcaattgcaacctcatgagtataattca
ggaactttcacactttccaatttgggtatgtttggagttgacaggtttgatgccatactc
ccaccaggccagggtgctatcatggctgttggagcgtctaagcccactgttctggctgat
aaagatggattcttcagcgtgaagaataaaatgctggtgaatgtaactgctgatcatcga
ataatatatggtgctgacttggccgcattcctccagacattctcaaaaatcattgaaaac
ccagaaagcctgacattatag

DBGET integrated database retrieval system