KEGG   Vigna radiata (mung bean): 106772881Help
Entry
106772881         CDS       T04126                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00500  Starch and sucrose metabolism
vra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106772881
Enzymes [BR:vra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106772881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 106772881
NCBI-ProteinID: XP_014514988
UniProt: A0A1S3V9G5
LinkDB All DBs
Position
9
AA seq 421 aa AA seqDB search
MDSFSRLSIFCLFISLLPLFSSPALLFQGFNWESSKKGGWYNSLKNSIPDLANAGITHVW
LPPPSQSVSPEGYLPGRLYDLDASRYGSKNELKSLIAAFHEKGIKCLADIVINHRTAERK
DGRGIYCIFEGGTPDSRLDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQVQR
ELSEWMNWLKTEIGFDGWRFDFVKGYAPSISKIYMEQTRPDFAVGEKWDAISYGQDGKPN
YNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPPGMIGVKPEN
AVTFIDNHDTGSTQRLWPFPSDKVMQGYAYILTHPGTPSIFYDHFFDWGLKEQIAKLSSI
RLRNGINEKSSVKIMASEGDLYVAKIDNKIMVKIGPKMDLGNLIPSNLHVATSGQDYAVW
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggattccttctctcggctcagcattttttgtctcttcatttcactccttcctcttttc
tcttcccctgccttgctgtttcaggggttcaactgggaatcaagtaagaaaggggggtgg
tacaactctcttaagaactctattcccgaccttgcaaatgcaggaatcactcatgtgtgg
ctccctcctccctctcaatctgtttctcctgaaggatatcttccaggaaggctatatgat
cttgatgcatcaagatatggatccaagaatgaactgaagtccctgattgctgcttttcat
gagaaggggataaagtgcctagctgacatagtgatcaaccacagaactgcagagaggaag
gatgggagaggaatatattgtatctttgaaggtggtactccagattcacgccttgattgg
ggtccatctttcatttgcagagatgacactgcttattctgatggcactggaaacaatgac
agtggagagggctatgatgctgcacctgacattgatcatctcaatccacaggtgcaaaga
gagttgtcagaatggatgaactggctcaaaactgagattggttttgatggatggaggttt
gattttgtgaagggctatgcccctagcatctccaagatctatatggaacagactaggcca
gattttgcagtaggtgagaaatgggatgctatctcatatgggcaggatgggaagccaaac
tataaccaagatagtcaccgaggggcactggtgaattgggttgaatctgcaggtggagct
attactgcatttgatttcacaacaaaaggaattcttcaagctgctgttcaaggagaatta
tggaggttgatagatccaaatggcaagcctcctggaatgattggtgtgaaaccagaaaat
gcagtaactttcattgacaaccatgacactggttccacacagagactttggccattccct
tctgacaaagtcatgcaaggatatgcctacattctaacacaccctggcaccccctcaata
ttctacgaccacttctttgattggggcttgaaggagcagattgcaaaattgagtagcata
aggttgaggaatgggatcaatgagaaaagcagtgttaaaattatggcatctgaaggtgac
ctttatgttgcaaagatagacaacaagatcatggtgaagatagggccaaagatggacctt
ggaaaccttattccgtcaaatctccatgttgctacctctggccaagactatgctgtgtgg
gagtga

DBGET integrated database retrieval system