KEGG   Vigna radiata (mung bean): 106774429Help
Entry
106774429         CDS       T04126                                 

Definition
(RefSeq) twinkle homolog protein, chloroplastic/mitochondrial
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
vra  Vigna radiata (mung bean)
Brite
KEGG Orthology (KO) [BR:vra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vra03029]
    106774429
Enzymes [BR:vra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     106774429
Mitochondrial biogenesis [BR:vra03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    106774429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Toprim_4 Toprim_2 DnaB_C Toprim AAA_25 ATPase_2 GT-D AAA_29
Motif
Other DBs
NCBI-GeneID: 106774429
NCBI-ProteinID: XP_014516908
UniProt: A0A1S3VEY1
LinkDB All DBs
Position
10
AA seq 698 aa AA seqDB search
MRLRYPYTLRPFFFSSKLSTMTPQTLFHSSPFPTLKNTPFCQRHRFLPHRPFFTVFCSKP
TSRNSSSPLRTNGYIDVSHASIPRPVQLANSEAKSVELQFNILRKKLEAVGMETGICVPG
QKNHLICPKCQGGDQSESSLSLYIAPDWGSAAWVCFRGKCGWKGSTQAFAGRRSAASIVT
PVKKKREITEEELQLEPLCDELLAYFSERLISKETLERNAVKQRRYADQIVIAFTYLRNG
SLISCKYRDVNKVFWQEANTEKIFYGLDDIVGQSDIIIVEGEMDKLAMEEAGFLNCVSVP
DGAPPSVSSNDLPPQEQDKKYQYLWNSKDELKKATRVILATDGDPPGQALAEELARRIGK
EKCWRVRWPKKGRLDNCKDANEVLMYLGPDALKEVIEKAELYPIRGLFNFRDYFDEIDAY
YHRTLGYDIGISTGWNNLNDLYNVVPGELTIVTGVPNSGKSEWIDALLCNLNELAGWKFA
LCSMENKVREHARKLLEKHLKKPFFNLRYGEXXXXXXVXEFERGKLWLSDTFSLIRCEDD
ALPNIRWVLDLAKAAVLRHGVRGLVIDPYNELDHQRPPNQTETEYVSQMLTLVKRFAQHH
GCHVWFVAHPRQLQNWVGGPPTLYDISGSAHFINKCDNGIVIHRNRDPEAGPVDQVQVCV
RKVRNKVAGTIGEAILMYNRVTGEYTATDSKRPTDRKK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttcgttatccctacactctacgtcccttctttttttcttcaaaactctctacc
atgacccctcaaaccctcttccattcttctccattcccaaccctcaaaaacactcctttc
tgtcaaagacaccgttttcttcctcatagacccttcttcaccgtcttctgttccaaaccc
acttcaaggaactcttcatcgcctctcagaacaaacggctacattgatgtctctcatgcc
agtatccctagaccggttcaattggcgaactccgaggcaaagagtgtggagttgcagttc
aatattttgaggaagaagttggaggctgttgggatggaaactggaatatgtgtgccgggg
cagaagaatcacttgatctgtccaaagtgccaaggtggcgatcaatcagaaagcagccta
tctctttacattgcaccagattggggatctgctgcatgggtgtgttttcgaggaaagtgt
ggttggaaaggcagcacacaggcttttgctggaaggagatctgcagcaagtatagtaacc
ccggttaaaaagaaaagagaaattacggaggaggaattacagcttgaaccactttgtgat
gagctgcttgcttatttttcagagcgcttgatttcgaaagagactctggagagaaatgct
gttaagcagagaagatatgcagatcagattgtgattgctttcacatatcttcgaaatgga
tcacttattagttgcaagtatcgagatgtcaacaaggtgttttggcaggaagcaaacact
gaaaagatcttttatggattggacgacatagtaggacaaagtgatataatcattgttgaa
ggtgaaatggacaagctggcaatggaagaagctggcttcttgaactgtgtcagtgttcct
gatggggcacctccatcagtgtcctcaaatgacttgcctcctcaagaacaggacaaaaag
tatcagtatctttggaactctaaagatgaactaaagaaggcaacccgggttatacttgcc
actgatggggatccacctggtcaagctttggctgaggagcttgcacgccgcattgggaaa
gagaaatgctggcgagtcaggtggcctaaaaaagggagattagacaattgcaaagatgcg
aatgaggttctcatgtatttgggccctgatgcactcaaggaagtgattgagaaagcagaa
ttatatccaatacgtggattgtttaacttcagagattactttgacgagattgatgcatac
tatcatcgaaccttaggatatgatattggtatctcaactgggtggaataatctgaatgac
ttgtacaatgttgtaccaggagaactgaccatagtaactggagttcctaactctgggaag
agtgagtggattgatgctcttctctgcaatcttaatgaattggctggctggaaatttgca
ctttgttccatggagaacaaggtcagagaacatgctcgaaaacttttggagaaacacttg
aagaagccattctttaatctacgttatggtgaaaanntnganngaatnagngtgnaggag
tttgaacggggcaagctttggttgagcgatactttttctctcataaggtgtgaagatgac
gctcttccaaatataagatgggtccttgaccttgcaaaagctgctgtattaaggcatggg
gtgcgaggacttgtaattgatccctataacgagcttgatcatcagagacctccaaaccag
accgaaacagaatatgtgagtcagatgcttaccttagtcaaacgctttgcacaacatcat
ggatgccatgtttggtttgtagcacatcctaggcagctgcaaaattgggttgggggtcct
cctactctctatgatataagtggaagtgcacacttcataaataagtgtgacaatggaatt
gttattcaccgaaatcgggatcctgaagctggacctgtggatcaagtacaggtttgtgtt
cgaaaggtacgtaacaaggtggcagggacaataggtgaagccatattgatgtataatagg
gtaactggtgaatacacagcaacagatagcaagagaccaactgatagaaagaaatag

DBGET integrated database retrieval system