KEGG   Vigna radiata (mung bean): 106775060Help
Entry
106775060         CDS       T04126                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00250  Alanine, aspartate and glutamate metabolism
vra00410  beta-Alanine metabolism
vra00430  Taurine and hypotaurine metabolism
vra00650  Butanoate metabolism
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Module
vra_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106775060
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106775060
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106775060
   00430 Taurine and hypotaurine metabolism
    106775060
Enzymes [BR:vra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     106775060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 106775060
NCBI-ProteinID: XP_014517585
UniProt: A0A1S3VH24
LinkDB All DBs
Position
1
AA seq 499 aa AA seqDB search
MVITSTATHPDEQAQSIFSTFASRYVCEPIPRFKIPEKSIPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNIIANLFHAPINEDET
AVGVGTVGSSEAIMLAGLAFKRKWQTKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLTEGYYVMDPVKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTVKNKETGW
DTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLP
DELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCLENTRVLKEG
IERTGQFNIISKDIGVPLLAFSLKDSSQHSVFEISDQLRKFGWIVPAYTMPPDAQHIAVL
RVVVREDFSRGLAQRLVSDIEKVMKLLDSLPSTVSNKTAHITAITNETSEKIKKSATETQ
REIALYWKRLVGGKKHGAC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacatccactgctacacacccagatgaacaagcacagagcatattttctacc
tttgcttccagatatgtgtgtgaacctattcccaggttcaagataccagagaaatcaata
ccaaaggatgctgcttatcagataataaacgatgagttgatgttggatggcacaccaagg
ctcaacttggcctcatttgtgaccacttggatggagcctgagtgtgacaagctcataatg
gcttcacttaacaagaactatgttgacatggatgagtaccctgtcaccactgaactccag
aaccggtgcgttaatataatagcaaatctattccacgctcctataaatgaagatgagaca
gcagtaggtgtgggaactgtggggtcatcagaggcaataatgttagcaggtttggctttc
aaaaggaaatggcagaccaagagaaaagcagaaggcaaaccatatgacaagcctaacata
gttactggggctaatgtgcaggtttgttgggaaaaatttgcacggtactttgaggtagag
ctcaaggaagtgaaactcacagagggatactatgtgatggacccagtgaaagcagttgaa
atggtggatgagaacaccatttgtgttgcagccattttggggtcaactatgactggagaa
tttgaggatgtgaaacttctcaatgaacttctcactgtaaagaacaaggagacaggttgg
gataccccaattcatgtagatgctgccagtggggggtttattgctccatttctctatcct
gatctagagtgggattttcgtttgccattggtgaaaagcatcaatgttagtggtcacaag
tatggtcttgtctaccctggtgttggttgggttgtctggaggagtaaggatgacttgcca
gatgaacttgtttttcacatcaattatcttggttctgatcagcccactttcacattgaat
ttctctaaaggatccagtcaaattattgcacaatattaccagtttattcggcttggcttt
gagggttataaaaacatcatggaaaattgcttggagaatacaagagttctgaaagaggga
attgagagaacagggcagtttaacatcatctccaaggatataggggtgccccttttggcc
ttctctttgaaagacagcagccaacactcagtgtttgagatatcagaccagctgagaaaa
tttggctggatagttccagcctacacaatgccaccagatgcacaacacattgcggtccta
agggtggtggtcagggaggatttcagccgtggcttggctcagagacttgtttctgacata
gaaaaagttatgaagctcttggactcacttccaagcactgtctctaacaaaactgctcat
atcacagccatcactaatgagactagtgagaagataaaaaagagtgcaacagagactcag
agagagattgctttgtactggaagcgacttgtgggtggcaagaaacatggagcatgttag

DBGET integrated database retrieval system