KEGG   Vigna radiata (mung bean): 106775777Help
Entry
106775777         CDS       T04126                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:vra00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106775777
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106775777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 106775777
NCBI-ProteinID: XP_014518445
UniProt: A0A1S3VJI2
LinkDB All DBs
Position
10
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTVYFSQDGNGPTTVTGTLAGLKPGHHGFHVHALGDTTNGCLSTG
PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVTFSITDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggcagcagtgagggtgtcactggaactgtctacttc
agtcaggacggaaatggtccaacaactgtaactggcactcttgctggtcttaagcctggt
caccatggcttccatgtccatgccttgggggacactaccaatggttgcctttcaactgga
ccacatttcaatcctaataacaaggagcatggtgcccccgaggatgagaatcgccatgct
ggtgatctagggaatgtaaatgttggtgatgatggtaccgtcaccttcagtattactgac
agtcagattcctctcactggaccaaactccatcattgggagagctgttgttgtccatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaagtctactggaaatgctggt
ggcagagtagcatgtggtatcattggtttgcaaggataa

DBGET integrated database retrieval system