KEGG   Vigna radiata (mung bean): 106776167Help
Entry
106776167         CDS       T04126                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00052  Galactose metabolism
vra00500  Starch and sucrose metabolism
vra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106776167
   00500 Starch and sucrose metabolism
    106776167
Enzymes [BR:vra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106776167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106776167
NCBI-ProteinID: XP_014519009
UniProt: A0A1S3VLP8
LinkDB All DBs
Position
10
AA seq 922 aa AA seqDB search
MYIMNLYAIVFYLFNSQTMATPWNTQLTPTLFTVCVFLIFSCASPSEEKPVGYGYTISTA
NNYPITNSLIANLNLIKSSSVFGPDIPHLSLSASFENKDRLRVRITDSNHQRWEIPQHVI
PRASSSQYHPLRFLNSEQGFQHSLTLTHPDSDLVFTLHDTTPFGFTLSRKSSNDVLFDTA
PDPSNPQTFLVFKDQYLQLSSSLPPQRASLYGLGEHTKSSFKLRPNQTLTLWNADIASAN
PDVNLYGSXPFYLDVRSPSPDGRVKAGTSHGVLLLNSNGMDIVYGGDRITYKATGGVFDL
YFFAGSSPELVLEQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLQGVVANYAKAAIPLE
VMWTDIDYMDAYKDFTFDPINFPLEKMRSFVDTLHKNGQKYVLILDPGISVNETYETYIR
GLKADIYIKRNGSNYLGKVWPGEVYYPDFLNPGSQAFWGGEIKLFRDQLPFDGLWIDMNE
LSNFITSPSIPSSSLDNPPYKINNVGDQRPINDRTVPATSLHYGNVTEYNAHNLYGLLES
KVTNKALVDITGKRPFILTRSTFVSSGKYAAHWTGDNAATWNDLAYSIPSILNSGIFGIP
MVGADICGFGGNTTEELCRRWIQLGAFYPFARDHSELNSIRQELYIWESVAASARKVLGL
RYRLLPYFYTLMYEAHTKGIPIARPLFFSFPEDVTTYEISSQFLLGKGVLVSPVLQSGAT
TVDAYFPKGTWFDLFDVSNSVIAESGKYVTLDAPPDHINVHVGEGNVLALQGEALTTDAA
RKTAFELVVVISGSGNSYGEVYLDDGEALDVAGVKYEWTLVSFYGAIQNNSVVITSKVTN
GRFALDQRWIIDKITFLGIPKHQKFNRMDLSEKELNIVNRTSSMTNAVMKSHFDTSSEFV
SVQVSKLSLLIGEEFKLVVEIK
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaatctatatgctatcgttttctatctcttcaactctcagactatggct
acaccatggaacactcaactcacacccactctctttactgtttgtgtttttctcatcttc
tcctgcgcttcaccgtcagaagaaaaaccagttggctatggctacaccatctcaactgct
aacaattatcccataaccaactctttgattgcaaaccttaaccttatcaaatcctcctct
gttttcggacccgacataccacacctctccctctctgctagttttgagaacaaggatagg
ttgagagtgagaatcactgactctaatcatcaaagatgggaaattccacagcatgtcatt
cccagagcttcctcttctcagtatcaccctcttcgcttcctcaatagcgaacaaggtttc
caacactctctcactcttacacatccagactcagaccttgttttcactctccacgacacc
accccatttggcttcactctctctcgcaaatcctccaacgatgttctctttgataccgca
ccagacccttccaaccctcagacttttcttgtcttcaaagaccagtacttgcagctctcc
tcctcgctcccgccacaaagagcctctctttacggcctnggggaacacaccaagagctcc
ttcaagctccgacccaaccagacccttacactgtggaatgcagatattgcaagcgccaac
ccggacgtcaacctttatggctctcancctttttacttggacgtgagatcaccctcccca
gatggaagagtgaaggctggcacctcacatggggtgttgctgctcaacagcaatggaatg
gatattgtgtatggcggtgatcgcattacttataaggccactggtggggtttttgatctc
tatttcttcgctggatcctccccagagctggtgttggaacagtacactgaactcattggc
aggcctgctccaatgccttattggtcctttggttttcatcagtgtcgatatggctacaag
aatgtaagtgatctccagggtgtggttgctaactatgcaaaagcagctataccccttgaa
gtaatgtggacagatattgattatatggatgcatataaagattttacatttgatcccatc
aactttccgctggagaagatgagaagttttgttgacactcttcacaaaaatggtcagaaa
tacgtacttatcttggatccaggtatcagtgtaaatgagacatatgaaacctatattaga
ggtttgaaggctgatatctacataaagagaaatggaagtaactatcttggtaaagtttgg
cctggagaagtttattaccccgatttcctaaaccctggaagccaagcattttggggtggg
gaaatcaaattatttagggatcagctgccttttgatggtctctggattgacatgaatgag
ttatctaatttcatcacttctccctccattccgtcttctagtcttgataaccctccctat
aaaattaacaatgttggagaccaacgacccattaatgacagaacagtcccagcaacatct
ttgcactatggtaatgtcactgagtacaatgcccacaatttgtatggactactagaatcc
aaagttactaacaaggcattagtggatataactggtaaaaggccattcatcctaactaga
tcaacttttgtgagttctggtaagtatgctgcacattggacaggagataatgctgctaca
tggaacgatttggcatattcaattccatcgatattaaattctggaatctttggaattcca
atggttggagcagatatctgtggttttggtggaaatacaactgaagaactttgccggcgc
tggatccagttgggggctttttacccctttgccagagatcattcggaactaaactccatc
agacaagagctttacatttgggaatcagttgcagcatcagctaggaaagtgcttggactt
cgntaccgtcttctcccttatttctacacactaatgtatgaagcacatacaaaagggata
cccattgcacggcctcttttcttttcattccccgaggatgtcacaacgtatgaaataagc
tctcagtttctattaggcaaaggggttctggtatcacctgtactacaatctggggcaacc
actgttgatgcatactttcctaaaggaacctggtttgacctctttgatgtctcaaattca
gtgattgcagaatcaggcaagtatgtgactcttgatgctccacctgatcacataaatgtg
catgttggggaaggtaatgttttggccttgcaaggagaagcattgacgactgatgctgcc
cggaaaactgcatttgaacttgtggtagttatcagtggcagtggaaatagttatggtgaa
gtgtatttggatgatggggaagcattagacgtagcaggggtgaaatatgagtggacattg
gtaagcttttacggggctatacagaacaatagcgttgttattacatctaaggtgactaat
ggaagatttgctctggaccaaaggtggatcatagacaagataactttcttggggataccc
aagcatcagaaattcaatagaatggatttgtcagagaaagagttgaatattgtgaataga
acaagttcaatgactaatgcagttatgaaatcacattttgatacctcctctgagtttgtg
agtgtacaagtttctaaattgtcacttcttattggagaggaattcaagctggtggtagaa
atcaagtag

DBGET integrated database retrieval system