KEGG   Vigna radiata (mung bean): 106778197Help
Entry
106778197         CDS       T04126                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00220  Arginine biosynthesis
vra00250  Alanine, aspartate and glutamate metabolism
vra00710  Carbon fixation in photosynthetic organisms
vra01100  Metabolic pathways
vra01200  Carbon metabolism
vra01210  2-Oxocarboxylic acid metabolism
vra01230  Biosynthesis of amino acids
Module
vra_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:vra00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106778197
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106778197
   00220 Arginine biosynthesis
    106778197
Enzymes [BR:vra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     106778197
Amino acid related enzymes [BR:vra01007]
 Aminotransferase (transaminase)
  Class I
   106778197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 106778197
NCBI-ProteinID: XP_014521621
UniProt: A0A1S3VTB0
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MRRIVADRFRRLFNRSFLLHRHHHNHNHPPFPASSSLTSHYPFSPYRFFFSTPFSSMASD
SPFPVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLLANPGSHPFDEILYCNIGNPQSLG
QPPITFFREVLALTDHPSILDKSETQGLFSTDAIERAWQIVEQIPGRATGAYSHSQGVKG
LRDTIAAGIGERDGFPANPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSAS
IALHGGFLVPYYLDEATGWGLEIPELKKQLDAAKSKGINVRALVVINPGNPTGQVLSEEN
QRNIVDFCKQEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGENDITLVSFQSVSKG
YHGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESF
MAEKGNILASLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKAAEEAKTAP
DNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRLTEFHEKFMDEF
RD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaatcgttgcagacagattcaggcgccttttcaaccgttcgttccttcttcat
cgtcatcatcacaatcacaatcaccctccctttcctgcttcttcctctctcacttctcac
tatccgttttccccctatcgcttcttcttttctactcctttttcttccatggcttctgat
tcacctttccccgtcactgctcaaaacatcaacccaaaggttctgaaatgtgagtacgcc
gttagaggagaggttgtcacacttgctcagaatttgcaaaaggatttactggccaatccc
ggttctcatccatttgacgagatactttactgcaacattggaaatcctcagtctcttggc
cagcctccgataacctttttccgagaggttcttgcgttaactgatcatccatctatatta
gacaaaagcgaaacacagggtttgttcagcactgatgcaatagaacgagcttggcagatt
gtggaacagattcccggtagagcaactggtgcctatagccacagccagggtgtcaagggt
ttgcgtgatacaatagctgctggaattggagagcgtgatggttttcctgccaatcctgat
gacattttcatgacagatggtgcaagccctgcagtccataatatgatgcaattacttatt
aggtcggaaaatgatggtattttgtgtcccattccacagtatcctctatactcagcttca
attgccctccatggtggcttcttggtaccttattatctagatgaagcaaccggttgggga
ttggaaatacctgaactcaagaagcaattggacgctgccaagtctaagggcatcaatgtt
agggctttagttgttataaatcctggcaatccaacggggcaggttctttctgaggaaaat
cagcgcaacatagtagatttttgcaagcaagaaggtttggttcttttagctgatgaggta
tatcaagaaaatgtttatgtacctgagaagaaatttcactcattcaagaaggtatctcgg
tccatgggatatggtgagaatgacatcactttagtatcctttcaatcagtctccaaaggc
taccatggggagtgtgggaaacgaggaggttatatggaggtgactggcttttctgcagaa
gtgagggagcaaatatataaagtggcatctgtcaacctttgctctaatatctctggtcaa
attcttgcaagcttggtcatgagtccacctaaggttggagacgagtcctatgaatcattc
atggccgagaagggaaatattttggcatcacttgctaggcgtgcaaagacactagaagat
gcattcaacaaactagagggtgtaacatgcaacaaagcagaaggggcaatgtatctgttt
ccccaaattcgtctgtctcaaaaggctatcaaagctgcagaggaggcaaaaactgcacct
gataacttctattgcaaacggttgcttaatgccacaggagtagtagttgttcctggttct
ggttttggacaggttcctggcacatggcatttcagatgcaccattttgccccaagaagaa
aagattccagccattgtctcccgtttgacagagttccatgaaaaattcatggatgagttc
cgtgactaa

DBGET integrated database retrieval system