KEGG   Vigna radiata (mung bean): 106778590Help
Entry
106778590         CDS       T04126                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00620  Pyruvate metabolism
vra00710  Carbon fixation in photosynthetic organisms
vra01100  Metabolic pathways
vra01200  Carbon metabolism
Module
vra_M00168  CAM (Crassulacean acid metabolism), dark
vra_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
vra_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
vra_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106778590
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106778590
Enzymes [BR:vra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     106778590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 MCM_N
Motif
Other DBs
NCBI-GeneID: 106778590
NCBI-ProteinID: XP_014522045
UniProt: A0A1S3VUR0
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MMASRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQD
CYELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRI
KLLKKGDFADENSAMTESDIEETLKKLVTQLKKTPQEVFDALKNQTVDLVLTAHPTQSVR
RSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRA
GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMAANMYFSQIEDLMFELSMWRCTDELRVRAHELHRSSKRDAKHYIEFWKQ
IPPNEPYRVILGDVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSLC
ACGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYREWSEE
KRQEWLLSELSGKRPLFGHDLPKTEEITDVLETFHVISELPKDNFGAYIISMATAPSDVL
AVELLQRECHVKEPLRVVPLFEKLADLEAAPASVARLFSIDWYRDRINGKQEVMIGYSDS
GKDAGRLSAAWALYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPAWRALMDEMAVIA
TQEYRSVVFREPRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVVEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALF
DKLLVPEELRPFGASLRAKYEETKNFLLQVAGHKDLLEGDPYLKQRLRLRDSYITTLNVL
QAYTLKRIRDPDYHVKLRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgatggctagccgtaacattgagaagatggcctcgattgatgctcagttgaggttgctg
gcaccacgtaaggtctctgatgatgacaaactggttgagtatgatgctcttttgttggac
cgtttccttgacattcttcaggatttgcatggtgaagatatcagacaaacggttcaagat
tgttatgagctgtcagctgaatacgaaggggagcatcgacctgaaaagttggaggaactt
gggaatatgctgactggtcttgatgctggggattcaattgttattgccaaatcattttct
cacatgctcaatttggccaacttggcagaagaagttcaaattgcttaccgaagaaggatc
aagttactgaagaagggtgattttgcggatgagaactctgccatgacagagtcagacatt
gaagagaccttgaagaagcttgtgactcaactgaagaagaccccccaggaagtctttgat
gctctgaagaaccaaactgtggatttggtcctaactgctcatcctactcagtctgttcgc
agatctttgctgcaaaagcatggaaggataaggaattgtttgacacaattatatgccaaa
gacataacaccagatgataagcaggaacttgatgaggctttacaaagagagattcaagct
gcatttcgcacagatgaaattcgaaggactccgcctacaccacaagatgagatgagggcg
ggaatgagctactttcatgagacaatttggaaaggtgtaccaaagtttctgcgccgggtt
gatacagctctgaagaacattggaataaacgaacgtgtcccatataatgcccctgttatt
cagttctcttcttggatgggaggagatcgtgatggtaatccaagagtaacacctgaagtt
acaagggatgtgtgtttgctggctagaatgatggctgctaatatgtacttctctcagata
gaggatctcatgtttgagctgtctatgtggcgttgcactgacgagctccgtgttcgtgct
catgaactccataggtcctcaaagagagatgcaaaacattacattgagttttggaaacag
attcctccaaatgaaccatatcgtgttattcttggtgatgtcagagacaagctctataac
acacgtgaacgtgctcgccagttactagccaatgggacctctgatatcccagaggagaca
accttcactaatgttgagcagttcctggagcctcttgaactatgctataggtcactctgt
gcatgtggtgacagaccaatagcagatggaagcctacttgatttcctgcggcaagtttcc
acatttggactctcacttgtgaggcttgacatccgtcaagagtcagataggcacactgat
gtaatggatgcaatcacaaaacacttagaaattggatcataccgagagtggtctgaggaa
aagaggcaggagtggctcttgtctgaactcagtggaaaacgccctctctttggccatgac
cttcccaaaacagaagaaatcactgatgttttggaaaccttccatgtcatttcagagcta
cctaaagacaactttggtgcctacatcatatcaatggccacagccccatctgatgtgctt
gcggtggagcttttacaacgtgagtgccatgtgaaggagccactgagggtggtgccattg
tttgaaaagcttgctgatcttgaggctgctccggcttccgtggcgcgacttttctccata
gattggtacagagaccgcatcaatgggaagcaagaagttatgatagggtactcagactca
ggaaaagatgctggccgtctttcagctgcttgggccctttacaaggctcaagaggaactc
gtgaaggttgctaaggagtttggtgtgaagcttacaatgtttcatgggagaggaggaact
gttggaagaggaggaggaccaactcatcttgctattttgtctcagccaccagacaccatt
catggctcacttcgggtaacggttcagggtgaagtcattgaacagtcatttggagaggag
catttatgctttaggacacttcaaaggttcactgcagccacgcttgagcatggcatgcat
cctcctgtgtcaccaaaacctgcatggcgcgctctcatggatgagatggctgtcattgcc
actcaggagtatcgctctgttgttttcagagagcctcgttttgttgaatatttcagacgt
gcaactcctgagttggagtatggaagaatgaacattggcagtcgtccatcaaagagaaag
ccaagcggaggaattgaatcgctacgtgctattccttggatttttgcatggacacaaaca
aggtttcatttgccagtgtggcttggttttggggcagcatttaagcatgttgttgagaaa
gatccaaagaatctgcaaatgcttcaggatatgtacaaccaatggcctttcttcagggtc
acccttgacttggttgagatggtgtttgccaagggagaccctgggattgcagccctattt
gataaactcctagtgccagaagagctacgtccatttggagcgagcttaagggctaaatac
gaagaaaccaagaactttctcctccaggttgctgggcacaaggatcttcttgaaggggac
ccctacttaaagcaaagacttcgacttcgtgactcatacatcacaaccctgaatgtgctg
caagcctacacattgaagagaattcgtgatcctgactaccatgtgaaactgaggccacac
ttgtcaaaggactacatggaatcaagcaagcctgcagcggagcttgttaaacttaacccc
aaaagcgagtatgcacctggccttgaagacacccttattttgacaatgaagggtattgct
gctggcatgcagaacactggttaa

DBGET integrated database retrieval system