KEGG   Vigna radiata (mung bean): 106779917Help
Entry
106779917         CDS       T04126                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00010  Glycolysis / Gluconeogenesis
vra00053  Ascorbate and aldarate metabolism
vra00071  Fatty acid degradation
vra00280  Valine, leucine and isoleucine degradation
vra00310  Lysine degradation
vra00330  Arginine and proline metabolism
vra00340  Histidine metabolism
vra00380  Tryptophan metabolism
vra00410  beta-Alanine metabolism
vra00561  Glycerolipid metabolism
vra00620  Pyruvate metabolism
vra00903  Limonene and pinene degradation
vra01100  Metabolic pathways
vra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106779917
   00053 Ascorbate and aldarate metabolism
    106779917
   00620 Pyruvate metabolism
    106779917
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106779917
   00561 Glycerolipid metabolism
    106779917
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106779917
   00310 Lysine degradation
    106779917
   00330 Arginine and proline metabolism
    106779917
   00340 Histidine metabolism
    106779917
   00380 Tryptophan metabolism
    106779917
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106779917
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    106779917
Enzymes [BR:vra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106779917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106779917
NCBI-ProteinID: XP_014523620
UniProt: A0A1S3VZ55
LinkDB All DBs
Position
Unknown
AA seq 535 aa AA seqDB search
MASPLRISRLISRTFFSTSFFSRGGNNYLGSRLSKYSTAAAIEEPIKPSVQVEYTQLLID
GKFVDAASGKTFPTLDPRTGEVIAHVAEGHSEDVDRAVAAARKAFDHGPWPRLTAYERQR
ILLRAADLIEKHNDEIAALETWDNGKPFEQSAKIEIPMLVRLFRYYAGWADKIHGLTVPA
DGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLSALYVAK
LFLEAGLPTGVLNVISGFGPTAGAALASHMEVDKLAFTGSTDTGKVVLELAAKSNLKPVT
LELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARA
LKRVVGDPFKGGIEQGPQIDSDQFEKILKYIRYGVESGATLETGGDRLGNKGFYIQPTVF
SNVKDDMKIAKDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTKNIDTANILTRAL
RVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccactcagaatttcaaggctcatctctcgcacctttttttctacttccttc
ttttcacgaggtgggaataattaccttggctcaagactctctaaatacagtactgctgct
gccattgaagaacccattaaaccatcagtgcaagtggaatatacccaactcttaattgat
ggaaaatttgtagatgctgcttccggtaaaacttttccaactttagatccaagaacgggg
gaagtgattgctcatgttgctgagggtcactctgaagatgttgatcgagctgttgcagct
gcacgcaaggcatttgatcatggtccatggcctaggctgacagcttatgaaaggcaaagg
atcttgttacgtgccgctgatctgattgagaagcataatgatgagattgcagcacttgag
acttgggataatggaaagccttttgaacaatctgctaagattgagattccaatgcttgtt
cgtctgtttcgatactatgctggttgggcagataagattcatggtctgacagttccagct
gatggaccttatcatgtgcaaactttgcacgaacccattggtgttgcgggtcagatcatt
ccttggaacttccctcttctcatgtttgcctggaaggttggaccagcattggcctgtggc
aacaccattgttctcaaaacagctgagcagacaccattatctgctttatatgtagcaaaa
ctatttcttgaggctggacttcctactggtgttttaaatgtgatatcgggatttggcccc
actgctggtgctgctcttgcaagtcacatggaggttgataagcttgcttttactggttcc
actgatactgggaaagttgtccttgaattggcggcgaaaagcaatcttaagcctgtaact
ttggagcttggtgggaaatccccgtttattgtgtgtgaagacgctgatgtagatcaggct
gttgagctagcacactttgctttattctttaatcagggacaatgttgctgtgctgggtca
cgaacatatgtacacgaaagagtgtacgatgagtttgttgagaaagcgaaggctcgtgct
ttgaaacgagttgttggtgatccattcaaggggggtatagagcagggtcctcagattgat
tcagatcaatttgagaaaatcctgaagtatatcagatatggtgttgaaagtggggctaca
cttgaaaccggaggagacagacttggcaacaagggcttctatattcaaccaactgtcttc
tcaaatgttaaggatgacatgaagattgcaaaggatgaaatctttggtccagtccaatcc
atattaaaattcaaggaccttggtgaggtagttcaaagagcaaacaatacacgttatggg
cttgcagcaggagttttcacaaagaacatagacactgccaacattttgactcgggcactg
agagtaggaacagtttgggtaaattgctttgacacattcgatgctgcaatcccctttggg
ggttacaagatgagtggtcagggcagagaaaaaggagagtatagtctcaagaactacttg
caagtgaaggctgttgttactcccttgaaaaacccagcatggctttga

DBGET integrated database retrieval system