KEGG   Vigna radiata (mung bean): 106780411Help
Entry
106780411         CDS       T04126                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
vra  Vigna radiata (mung bean)
Pathway
vra00061  Fatty acid biosynthesis
vra00071  Fatty acid degradation
vra01100  Metabolic pathways
vra01212  Fatty acid metabolism
vra04146  Peroxisome
Module
vra_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:vra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106780411
   00071 Fatty acid degradation
    106780411
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106780411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vra01004]
    106780411
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vra04147]
    106780411
Enzymes [BR:vra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     106780411
Lipid biosynthesis proteins [BR:vra01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   106780411
Exosome [BR:vra04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   106780411
  Exosomal proteins of breast cancer cells
   106780411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 106780411
NCBI-ProteinID: XP_014524185
UniProt: A0A1S3W0R3
LinkDB All DBs
Position
Unknown
AA seq 696 aa AA seqDB search
MDHTPAAQRRLRAVHDHLSPTADESPSHLRSNPTAGEFFSEQGYSVVLPEKLQTGKWNVY
RSMRSPLQLVSKFANHPEIGTLHDNFVRSVDTFRDYKYLGTRVRVDGTVGEYKWMTYGEA
GTARSAIGSGLIYYGVPKGSSIGLYFINRPEWLILDHACSAYSFISVPLYDTLGPDAVKY
IVSHAVVQVIFCVPETLNVLLSYLSDIPTVRLIVVVGGMDDQIPSVPSSSGVQIVTYSKL
LNVGRSNLQPFCPPKPDDIATICYTSGTTGTPKGAVLTHGNFIASIAGGTMDEKFGPSDV
YISYLPLAHIYERANQVMVVHFGIAVGFYQGDSMKLMDDLAVLRPTIFCSVPRLYNRIYA
GITNAVKTSGGLKERLFNAAYNAKRQALLHGKNPSPMWDRLVFNKIKEKLGGRVRLMASG
ASPLSPDIMEFLKICFGGRVTEGYGMTESTCVISCIDEGDPLGGHVGSPNPACEIKLVDV
PEMNYTSDDQPNPRGEICVRGPIVFRGYHKDEAQTREVIDEDGWLHTGDIGTWLPGGRLK
IIDRKKNIFKLAQGEYIAPEKIENVYAKCKFVAQCFVYGDSLNASLVAVVSVDHDVLKAW
ATSEGIMYNDLAQLCNDSRAKAVVLSEMDAAGRDAQLRGFEFVKAVTLVTEPFTLENGLL
TPTFKIKRPQAKEYFAKAISDMYSELSRTDNSQKTL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcacacgcctgctgcccaacgtcgtcttcgagctgttcacgaccacctctccccc
accgccgatgaatctccctcccacctccgatctaaccccaccgccggcgagtttttctca
gaacaagggtatagtgttgtactcccagagaagttacaaactggaaagtggaacgtttac
agatctatgcgatctcctctgcagctagtgagcaagtttgctaatcatcctgaaattggt
accctgcatgacaatttcgtgcgctcagttgacacctttcgggactacaaatatctggga
acacgcgtccgcgttgatggaactgttggggagtacaaatggatgacttatggagaagca
ggaacagcccggtcagcaataggttccggtttgatttattatggagtcccaaagggttcc
agtattggattgtattttattaatagaccggagtggctcattcttgatcatgcctgctct
gcatactcatttatatcagtacctctgtatgatactcttggtcctgatgctgtcaagtat
attgttagtcatgctgtcgtgcaagttatattttgtgtacctgaaacattaaatgtattg
ttgagctacttatctgatattccaactgtgcgtctaattgtggtagttggaggtatggat
gatcaaattccatcagttccatcatcatccggagttcaaattgttacatattcaaagcta
ctcaatgtgggacgcagcaatctccagcccttttgtccacccaaacctgatgacattgca
accatttgctatacaagtggtacaactggaaccccaaaaggtgctgttttgacccatgga
aactttattgcaagtattgctgggggtactatggatgagaaatttggcccttctgatgtt
tatatatcctatctccctttggctcacatttatgagcgagcaaaccaggtcatggtagta
cattttggcattgctgtgggattctaccagggggatagtatgaaattaatggatgacttg
gccgtcctaaggcctactatcttctgtagtgttcctcgactatataacagaatatatgct
ggtatcaccaatgctgttaaaacatctggtggtctgaaggagagactatttaatgctgcc
tacaatgctaaaaggcaggctttattgcatgggaagaacccttctccaatgtgggataga
ttagttttcaacaagataaaggaaaagcttggaggacgagttcggttaatggcatcaggt
gcctcgcctttatcccctgatatcatggaatttttaaagatttgctttggtggtcgggtg
actgaaggatatggaatgacagagagtacttgtgttataagctgcatagatgagggtgac
ccacttggtggtcatgttggctctcctaatcctgcctgtgagataaaacttgtggatgtt
ccagaaatgaactatacatctgatgatcagcccaatccccgtggtgaaatttgtgtcagg
ggtcccattgtttttcgaggttatcacaaagatgaagctcagacgagagaagtcattgat
gaagatggatggcttcatacaggagatattggaacgtggttacctggtggtagactaaaa
attattgacaggaagaaaaatatatttaagttggctcaaggcgagtatattgctcctgag
aagattgaaaatgtatatgccaaatgcaagtttgtggcgcaatgctttgtatacggtgat
agcctaaatgcttctttggtagctgttgtctcagtggatcatgatgtcttgaaagcatgg
gccacttcagaaggcataatgtataatgatttagcacaactttgcaatgattcaagagca
aaggcagttgtcttgtctgagatggatgctgccggacgagatgctcagcttagaggtttt
gaatttgtaaaagctgtcactttggtgaccgaaccctttacattggaaaatggtctgctt
actccaacattcaagattaagaggccacaagcgaaggaatatttcgcaaaagcaatatct
gatatgtacagtgaactctcaagaactgataattctcagaaaacgttgtga

DBGET integrated database retrieval system