KEGG   Vibrio rotiferianus: BSZ04_03740Help
Entry
BSZ04_03740       CDS       T05115                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vro  Vibrio rotiferianus
Brite
KEGG Orthology (KO) [BR:vro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSZ04_03740
Enzymes [BR:vro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSZ04_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 Thi4 Thioredoxin_9 Chalcone_N DAO NAD_binding_8 DUF5474
Motif
Other DBs
NCBI-ProteinID: ASI94143
LinkDB All DBs
Position
1:797041..798609
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSDLITVERDDNASA
RKPVMAVTNPAKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGGLFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAEKLMGAAHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNVDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGDT
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagaa
gttcgtttagtggttagtctagatgaaagcaaagcatcgaatgacatcttgtctctagcg
aaccaaatcgcagagatgagcgacctcatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccagtgatggcggtaactaacccagcaaaaggcacagcactacgctttgcaggc
ttgccaatgggtcacgaatttacctctctagtattggcactgcttcactctggcggtcac
ccaatcaaactagaaccagaagtgattgagcaaatcgcagcactagacaaagatctagac
gtagaaatcttcatttcactgtcgtgtcaaaactgtccggacgtagttcaagcgttcaac
atgatggcggcgatcaacccgaaagtaaaagcaaccatgatcgacggtgggttgttccaa
gatgaagtgaaacaacgcgacatcatggctgtaccaagcgtattcgtgaacggtgagcta
ttcggtcaaggtcgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcaagc
gagaaagcggcgaaagcactgagcgaaaaggacccatacgacgtacttgttgtcggcggt
ggccctggtggtagcgcagctgctctatacgctgctcgtaaaggtattcgtactggcgtt
gttgctaaacgctttggtggtcaggttatggacaccatggcaattgagaacttcatttcg
gtaaaacgtactgaaggtccaaaactggcaactgacctagcagaacacctaaaagaatac
gacgtagatgtcgtgaccgagcaacaagctgagaagctaatgggtgcagcacacactgaa
gatggtttgattcacatccaacttgaaagcggcgcaacgctgaagagtaagagtgtcatc
cttagccctggtgcacgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgacggtccactgttcaaaggcaagaaaaccgca
gttatcggtggtggtaactcaggcatcgaagcagctatcgaccttgctggtatcgtagag
cacgtaacggttcttgaatttgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactcactaccgaacgtagacatcatcacaatggcgcaaactaccgaagtagtgggc
gacggtactcgcgtaacaagcttgaagtacaaagaccgcaacacagacgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctagtaccaaacacagaatggctaaaa
gattcagaagtagccctatctgagcgcggcgaaatcgaagtcggcagccgtggcgatact
agcctagaaggtgttttcgcagccggtgacgcaacaaccgttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcatttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system