KEGG   Vibrio rotiferianus: BSZ04_09050
Entry
BSZ04_09050       CDS       T05115                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vro  Vibrio rotiferianus
Brite
Enzymes [BR:vro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSZ04_09050
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ASI95202
UniProt: A0A510I9R7
LinkDB
Position
2:complement(38671..39279)
AA seq 202 aa
MSHIFPELPYEYDALEPYIDAKTMEVHYSKHHKTYYDKFMAATKGSALETQSLDDIFACI
SQHSPAIRNNGGGYYNHIIYWNCMSPDGGGEPQGALAQAINDKFGNFETFKDEFAQAAIN
TFGSGFAWLIVKDGEIHITSTSNQDNPLMDVAAQQGEPILALDVWEHAYYISYQNRRPEY
IDAWWNVVNWRAVEENYARALG
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtcgcacattttcccagagcttccgtacgaatacgatgcgttagagccgtacatcgat
gcgaaaaccatggaagttcactacagcaaacatcataaaacttattacgataaattcatg
gctgccacaaagggcagcgctctcgagacccaaagcctcgatgacatcttcgcttgcatt
tctcaacacagcccagcaattcgcaacaacggtggcggctattacaaccacatcatttac
tggaactgcatgtcaccagatggtggtggtgaacctcaaggtgccctagcacaagccatc
aacgacaagtttggcaacttcgagacattcaaagacgagttcgcacaagcagctatcaat
acttttggctctggcttcgcttggctaatcgtaaaggatggggagattcacattacctcc
accagcaaccaagacaacccattgatggacgttgccgcgcaacaaggtgagcctatccta
gcacttgatgtatgggagcacgcttactacatcagctaccaaaaccgccgtcctgaatat
atcgacgcatggtggaatgtagtgaactggcgagcggtagaagagaactatgctcgcgca
ttaggttaa

DBGET integrated database retrieval system