KEGG   Vibrio rotiferianus: BSZ04_11560Help
Entry
BSZ04_11560       CDS       T05115                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vro  Vibrio rotiferianus
Pathway
vro00564  Glycerophospholipid metabolism
vro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSZ04_11560
Enzymes [BR:vro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSZ04_11560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C 3HCDH_N Pyr_redox_2 FAD_binding_2 GIDA K_oxygenase NAD_binding_8 DUF4657
Motif
Other DBs
NCBI-ProteinID: ASI97963
LinkDB All DBs
Position
2:complement(565511..567070)
Genome map
AA seq 519 aa AA seqDB search
MSIQQNASTTNSSPTLDMIVIGGGINGAGIAADAAGRGLSVGLYEANDFASATSSASSKL
IHGGLRYLEHYEFRLVSEALAEREVILRKAPHVALPMRFRLPHRPFLRPAWMIRCGLFLY
DNLGRRTTLPGSKTVNLAKSGLLKPEMKTGFEYSDCWVDDARLVLLNVLAAKENNAEVRN
YCRVEKAHREGGIWHVTIHDVTTDQRFERKAKALVNAAGPWVKQFFDEGLEQTSPRNIRL
IKGSHIVVPRIHNEPQAYILQNKDNRIVFMIPYLDKFSIIGTTDVEYKGDPREVAISEDE
VDYLIDIVNQHFVHQLSREDVVWTYSGVRPLCDDESDSPQAITRDYTLELDAEYDHAPLL
SVFGGKLTTYRKLGEAAMKKLAPFLPEMGKDWTANQTLPGGNFSCSREQLAKMIHAKYSW
ASEAMLLRYVTQFGTQTWDLMEGTNNVEDLGHCFSEQASGVYQREIDYLMNHEMALTDED
ILWRRTKLGLYMNEEEKIVLAEYLKEKLQQKVVSLSQVS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaacaaaatgcttccacgacgaattcatcccctactctagatatgatcgtg
atcggtggcggcattaacggagccggtattgctgcagatgctgctggccgtggtttaagc
gtcggtttgtacgaagctaacgacttcgcatcggcaacctcttctgcaagttcaaaactg
atccatggcggattacgttaccttgaacactatgaatttcgtttggtttcggaagcgctc
gctgagcgtgaagtgatcttacgtaaagcaccacacgtggctctgccaatgcgcttccgt
ttacctcatcgtccatttttacgcccagcttggatgatccgctgtggtttgttcctttac
gataatttgggtagacgcaccacactgccaggcagcaaaaccgtcaacctagcaaaatca
ggccttttaaaacctgaaatgaaaaccggtttcgaatactcagattgttgggtagacgat
gcgcgcttagtcttacttaacgttctggctgcaaaagagaataacgcagaagttcgcaac
tactgccgcgttgaaaaagcgcaccgtgaaggcggcatttggcatgtcactattcatgac
gtaaccacagaccaacgtttcgaacgtaaagcgaaagctctggttaacgcagctggtcca
tgggtgaaacagttctttgatgaaggattagagcaaacctcccctcgcaacattcgtttg
atcaaaggttcgcacatcgttgttcctcgtatccacaacgagccgcaagcctacatccta
caaaacaaagataaccgtatcgtatttatgatcccttacttagataagttctcgatcatt
ggtacaaccgatgtggaatacaaaggcgatccgcgtgaagtcgcgatctccgaagatgaa
gtcgattacttgatcgatatcgttaaccaacactttgtccaccagctaagccgcgaagac
gtggtgtggacatacagtggtgtacgtccgttgtgtgatgatgagtctgactcaccgcaa
gcgatcacacgtgactacacactagaactggacgctgaatacgaccacgcacctttgctt
tcagtgttcggcggcaagctcacgacataccgtaagcttggtgaagcggcaatgaagaaa
cttgccccgttcctacctgaaatgggtaaagactggacggcaaaccaaacccttcctggc
ggtaacttcagttgcagccgcgagcaactggcgaagatgattcatgcgaaatactcgtgg
gcatcagaagcgatgttgctgcgctatgtgactcagtttggtacacaaacttgggatttg
atggaaggcactaacaacgtagaagatcttggccactgcttctcagagcaagcaagcggc
gtatatcaacgcgaaattgattacttgatgaatcacgaaatggcgctaaccgatgaagac
atcttatggcgtcgtacaaaacttggtttatacatgaacgaagaggagaaaatcgtactg
gcagaatatctaaaagagaagctgcaacaaaaagtcgttagcctctcacaagtaagttaa

DBGET integrated database retrieval system