KEGG   Vibrio rotiferianus: BSZ04_14010Help
Entry
BSZ04_14010       CDS       T05115                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vro  Vibrio rotiferianus
Pathway
vro00250  Alanine, aspartate and glutamate metabolism
vro00410  beta-Alanine metabolism
vro00430  Taurine and hypotaurine metabolism
vro00650  Butanoate metabolism
vro01100  Metabolic pathways
vro01110  Biosynthesis of secondary metabolites
vro01120  Microbial metabolism in diverse environments
vro02024  Quorum sensing
Module
vro_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSZ04_14010
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSZ04_14010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSZ04_14010
   00430 Taurine and hypotaurine metabolism
    BSZ04_14010
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSZ04_14010
Enzymes [BR:vro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSZ04_14010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ASI96097
LinkDB All DBs
Position
2:complement(1102977..1104623)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTIPEGPDSTLTKIEESLSQNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDKFYAKWMHSAKHSLGAFCSGGTIANITA
LWVARNKALKADGTFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEG
LVAIKTDGANRIVPSDLRAKIAELEAQKIKPIAVVGVAGTTETGTIDPLEEIAQVCKQHD
CHFHVDAAWGGATLMSNHYRKLLAGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKEQADFELVSEPELCLLTYRYLPESYRDALAQADGIQREKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPEKWQRMNTIVFRVVLANPLTSRDILSSVLDEQREIATQAPTLTGKIQE
LVDKILNQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgcagatgttagctttgagagcttgttaaagatcttcact
attcctgaagggccagactcaacgttaactaaaatcgaagagagcttgtctcaaaatcta
aaccagtttctacgcgagcatatcgtggcagaagaaaagcctttgcgtgaaattgaaaaa
gacttttcttctgctcagattcctgagcagccagagttcgtctctgatcataccgagcac
ttgttagatacgctcgtctcgcactcagtacacacctctgcaccaagctttattggacac
atgacttctgccctgccgtattttttaatgccgctgtcaaagatcatgattgctctaaac
caaaacttggtgaaaattgaaacatcaaaagcattcactccacttgaacgtcaagttctc
ggtatgctccatcgacttatatacggtcaggacgataagttttacgcaaagtggatgcac
agcgcgaaacactctcttggtgcgttttgctctggtggtactatcgccaatattaccgct
ctttgggttgcgcgaaataaagcgctaaaagcagacggcactttcaaaggcgtagaaaaa
gaaggcctcttcaaagccatgaaacattatggctatgaaggtttagcaatcttagtttca
gagcgcggccactactctctaaaaaaagcagctgatgtgctcgggttgggccaagaaggc
ctagttgcaatcaaaacagatggcgctaatcgtatcgttccgtccgacttaagagcaaaa
attgctgagcttgaagcccagaaaattaaaccaattgcagttgtcggtgtggctggaacg
actgaaactggcacgattgaccctcttgaagaaattgcacaggtatgtaaacaacatgat
tgtcatttccatgtcgatgccgcatggggcggcgcgacattaatgtcaaaccactaccgc
aagctacttgctggcgttgaattagccgattctgtgaccattgacgcgcacaagcaactt
tatatccctatgggcgctggtatggttctatttaaagaccctgatgcgatgaaatctatt
gaacaccacgctcaatatattctacgtaaaggttcaaaggatcttggtagtcatactctg
gaaggctcccgttctggcatggcgatgttggtctatgcggcaatgcatatcatcagccgc
ccaggctatgagttactcattgaccagagcattgagaaagcgcgttactttgctgatttg
atcaaagaacaggcagactttgagcttgtttccgaaccagaactttgcctgcttacttac
cgttacttgccagaaagttatcgggatgctcttgcacaagcagatggcatccagcgtgaa
aagctcaatgagcttatcaaccagctaactcaatttattcagaagcgccagcgtgaaact
ggtaagtctttcgtgtctcggactcggttgaacccagaaaaatggcagcgaatgaatacc
atcgtatttcgtgtcgttcttgctaaccctcttacaagcagggatatcctttcatcggtg
cttgatgagcagcgagagatcgcgacacaagccccaacccttactggaaagattcaagaa
ttagtcgataagattctgaatcaataa

DBGET integrated database retrieval system