KEGG   Vibrio rotiferianus: BSZ04_15975Help
Entry
BSZ04_15975       CDS       T05115                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
vro  Vibrio rotiferianus
Pathway
vro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vro01100  Metabolic pathways
vro01110  Biosynthesis of secondary metabolites
vro01130  Biosynthesis of antibiotics
vro01230  Biosynthesis of amino acids
vro02024  Quorum sensing
Module
vro_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSZ04_15975
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSZ04_15975
Enzymes [BR:vro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BSZ04_15975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DUF3287
Motif
Other DBs
NCBI-ProteinID: ASI96455
UniProt: A0A2K7SSR7
LinkDB All DBs
Position
2:1480474..1481526
Genome map
AA seq 350 aa AA seqDB search
MPIKTDELRTQPLGPMPTPAELGSVYPITDDVADRIAQSRRQIEKILTGEDDRILAIVGP
CSVHDTEAAIDYATRLASIQDKYKDELFIVMRTYFEKPRTVVGWKGLITDPNLDGSYALE
AGLHKARKLLLDINKLGLATATEFLDMITGQYIADLITWGAIGARTTESQIHREMASALS
CPVGFKNGTNGNVKIAIDAIRASKASHYFYSPDKHGRMTVYRTSGNPYGHIILRGGEKGP
NFDETSVKQACDALAEFDLPQRLIVDFSHANCQKQHRKQIEVAQDICDQIKSGSTRIAGI
MAESFIIEGNQPMTDINNLTYGQSITDPCLSWDDTVTMLDMLAEAVKSSK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcctattaaaacagatgaattgagaacccaaccattgggtccaatgcctacacccgca
gagcttggaagcgtgtatccaattactgacgatgtcgcggatcgtatagctcaatctcgc
cgtcaaattgaaaaaatcctaacaggcgaagacgatcgtattcttgctatcgttggccct
tgttcagtgcatgacacagaagcagcgatcgactacgcgacgcgccttgctagcattcaa
gataagtacaaagacgaactatttatcgtcatgcgcacttatttcgagaagcctcgtaca
gtagttggttggaaaggtcttatcactgaccctaacctagatggttcatacgcgctagaa
gctggtcttcacaaagcacgtaaactgctactggatatcaacaagcttggtcttgctact
gctactgagtttcttgatatgatcactggtcaatacattgcagatctgattacttgggga
gcgattggcgctcgcaccacagagtctcagatccaccgtgaaatggcgtctgctctttca
tgtccagttggctttaagaatggtacaaacggtaacgtaaaaattgccattgatgctatc
cgtgcatcaaaagcatcgcattacttctactctccagacaagcatggccgtatgacggtt
taccgtactagcggtaatccttatggccacatcattcttcgtggtggtgaaaaaggtcca
aactttgatgagacatcagtgaagcaagcgtgtgatgcacttgccgagttcgacttgcca
caacgtttgattgtagacttcagccatgctaactgccaaaagcaacatcgcaaacaaata
gaagtagcacaagacatttgtgaccaaattaagtcaggcagcactcgtattgctggtatc
atggcagagagcttcattattgaaggcaatcagccaatgactgatattaacaaccttact
tatggtcaatctatcactgacccatgtctgagttgggatgatactgtgactatgctagat
atgctggcagaagcagtaaaatccagtaagtaa

DBGET integrated database retrieval system