KEGG   Vibrio rotiferianus: BSZ04_20595Help
Entry
BSZ04_20595       CDS       T05115                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vro  Vibrio rotiferianus
Pathway
vro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSZ04_20595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vro02000]
    BSZ04_20595
Enzymes [BR:vro01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BSZ04_20595
Transporters [BR:vro02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSZ04_20595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_23 AAA_16 ABC_ATPase AAA_25 AAA_29 AAA_30 AAA_15 AAA NB-ARC Rad17 AAA_33 Viral_helicase1 NACHT
Motif
Other DBs
NCBI-ProteinID: ASI97290
UniProt: A0A2K7SS12
LinkDB All DBs
Position
2:complement(2530805..2531623)
Genome map
AA seq 272 aa AA seqDB search
MFNFDNTLGYEPPLDVHNLTDEQTAISIENLNLFYGQAQALHDISMRIPKGRVTAFIGPS
GCGKSTLLRCINRMNDLVEGCKVTGKVRLHGKNVYNPSVDVATLRRRVGMVFQRPNPFPK
SIYENVVYGLRLQGVKTRRTLDDAVERSLRSAALWDEVKDRLHENAFGLSGGQQQRLVIA
RAVAIEPEVLLLDEPTSALDPISTLTIEELINELKTQYTVVIVTHNMQQAARVSDHTAFI
HMGKLIEYSDADSIFTSPMKKQTEDYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactttgataatacattgggttatgagccgcccttggatgttcataatctaacg
gatgaacaaacggctatctctatcgagaaccttaatcttttctatggtcaggctcaggcg
ctgcacgatatttccatgcgcattcctaaagggcgtgtaacggcattcattggcccatca
ggctgtggtaaatcaacactattacgttgcattaaccgtatgaacgacttagtggaaggc
tgcaaggtgacgggtaaagttcgtttgcacggtaagaatgtctataacccaagtgttgac
gtggcaacattgcgtcgccgtgtcggtatggtattccaacgccctaatccatttcctaaa
tcaatttatgagaatgtggtttacggcctccgtctgcagggcgttaagactcgccgaact
ttggatgatgcggtcgagcgctcgttgcggtctgcggcattgtgggatgaagttaaagac
cgtttacatgagaacgcatttggactttctggtggacaacagcagcgcttggttattgca
cgtgccgtcgcgattgagccagaagtactattattagatgagccgacatcagcattggat
ccaatatcaactttaactattgaagagcttatcaatgagctcaagactcaatatactgtg
gttatcgttacccataacatgcagcaggcggcgcgcgtaagcgaccatactgcgtttatt
catatgggtaagttgattgaatactcggatgcggattcgatcttcacctctccaatgaag
aaacaaaccgaagattacatcaccggtcgttacggttaa

DBGET integrated database retrieval system