KEGG   Aliivibrio salmonicida: VSAL_I1197Help
Entry
VSAL_I1197        CDS       T00782                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00250  Alanine, aspartate and glutamate metabolism
vsa00410  beta-Alanine metabolism
vsa00430  Taurine and hypotaurine metabolism
vsa00650  Butanoate metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VSAL_I1197 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VSAL_I1197 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VSAL_I1197 (gadB)
   00430 Taurine and hypotaurine metabolism
    VSAL_I1197 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VSAL_I1197 (gadB)
Enzymes [BR:vsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VSAL_I1197 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAQ78882
UniProt: B6EJL8
LinkDB All DBs
Position
1:1304769..1306163
Genome map
AA seq 464 aa AA seqDB search
MPLHSKDTVRDDLLDDVYSSTDLSLSMPKYKMPEHEHDPRHAYQVVHDELMMDGNSRQNL
ATFCQTWVEDEVHKLMDECIDKNMIDKDEYPQTAELEARCVHMLADLWNSPDAENTLGCS
TTGSSEAAMLGGMALKWAWREKMKKLGKPTDKPNMICGPVQVCWHKFARYWDIELREIPM
EGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHEALDKLQEETGLDIPMHI
DAASGGFLAPFCDPELEWDFRLPRVKSINASGHKFGLSPLGVGWVIWRDASALHEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGKEGYRKIHQACYDTAVYLSAEIEKMGM
FDIIYDGKGGIPAMSWSLKEGVNPGFNLFDLSDRIRSRGWQIAAYAMPPKREDLVIMRIL
VRHGFSRDQADLLVADLKHCIEFFDKHPISHGSDEVESSGFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcattctaaagatacagtcagagacgatcttcttgatgatgtttattcatca
actgacctttccctatctatgccaaaatacaaaatgcctgagcacgaacatgatcctcgt
catgcttatcaagttgttcatgatgagctaatgatggatgggaattctcgacagaattta
gcgaccttttgccaaacttgggttgaagatgaagtccacaaactaatggacgaatgcatc
gataaaaacatgatcgataaggatgaatatcctcaaaccgcagagcttgaagctcgttgt
gtgcatatgttagctgatttatggaactctccagatgcagaaaatacgttaggttgttct
actacggggtcaagtgaagccgcaatgctcggcggaatggcgctaaaatgggcttggcgt
gaaaaaatgaaaaaacttggcaaaccaacagacaaaccaaatatgatctgtggtcctgtt
caagtgtgctggcataaatttgctcgttattgggatattgaattacgtgagatcccaatg
gaaggcgatcgtctaattatgacgcctgaagaagtgattaaacgttgtgatgaaaatacc
atcggtgtagttccaacgttgggtgtgacatttacttgtcagtatgaaccagtaaaagca
gtgcatgaagcgttagataaactacaagaagaaactggtttagatattccaatgcacatt
gatgcggcgagtggcggtttcttagccccattctgtgatcctgagttagagtgggatttc
cgtttacctcgtgtgaaatcaatcaatgcgtcaggccataaatttggtttgagtccatta
ggtgtgggttgggtaatatggcgtgatgcatctgcattgcacgaagatcttatttttaac
gtgaattacttaggtggcaacatgcctactttcgcgttgaacttctctcgccctggcggc
caaattgtagcgcaatactataatttcttacgtttaggtaaagaagggtaccgtaagatc
caccaagcgtgttacgacacggcggtgtatctttctgctgaaatcgaaaaaatgggcatg
tttgacattatttatgatggtaaaggtggtatccctgcaatgagttggtcgcttaaagaa
ggcgtgaaccctgggtttaacttgtttgatctttcagaccgaattcgttctcgcggttgg
caaattgccgcttatgcaatgccaccaaaacgtgaagacttggtgattatgcgtattttg
gttcgtcatggctttagccgagatcaagctgatctactggttgccgatctgaaacattgc
atcgagtttttcgataagcacccaatctcccatggtagtgatgaagttgaatcttcaggc
tttaatcacggttaa

DBGET integrated database retrieval system