KEGG   Aliivibrio salmonicida: VSAL_I1366Help
Entry
VSAL_I1366        CDS       T00782                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa03030  DNA replication
vsa03410  Base excision repair
vsa03420  Nucleotide excision repair
vsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VSAL_I1366
   03410 Base excision repair
    VSAL_I1366
   03420 Nucleotide excision repair
    VSAL_I1366
   03430 Mismatch repair
    VSAL_I1366
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vsa03032]
    VSAL_I1366
   03400 DNA repair and recombination proteins [BR:vsa03400]
    VSAL_I1366
Enzymes [BR:vsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VSAL_I1366
    6.5.1.6  DNA ligase (ATP or NAD+)
     VSAL_I1366
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VSAL_I1366
DNA replication proteins [BR:vsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VSAL_I1366
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VSAL_I1366
DNA repair and recombination proteins [BR:vsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VSAL_I1366
   NER (nucleotide excision repair)
    Other NER factors
     VSAL_I1366
   MMR (mismatch exicision repair)
    Other MMR factors
     VSAL_I1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CAQ79051
UniProt: B6EKG6
LinkDB All DBs
Position
1:1487015..1487869
Genome map
AA seq 284 aa AA seqDB search
MKVSTLSTLIGIGLFSAPMLAFDKSNTVPVSVLLATSYEEGIEVDKYWVSEKLDGIRAYW
TGSELLTRKGHKIMAPDWFIAPLPKHAIDGELWAGRGGFQQVASTVLDSQPDDELWAEIT
FMMFDIPHSIGMFPQRYSDLSLLVQGLATPHLKLVEHHPISSEDDLLKSLEEMAVNKGEG
LMLRKLDSIYRAGRSDDLIKLKKHYDDEAIIVGYTDGKGKFEGMVGALILQMPNGQEFKI
GSGLSNEVRENPPILGQQVTYRYNGFTDSGIPKFARYIAVREKY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatcaacattatcgacactcattggcatcggattgttctctgctcccatgctt
gcttttgataaatctaatacagtccctgtttctgtattgttggcaacaagctatgaagaa
gggatagaggttgataaatattgggtcagtgaaaagctcgatggaataagagcgtattgg
acggggtcagagttacttactcgtaaaggtcataaaatcatggcacccgattggtttatt
gcgccgcttcctaagcacgcgattgatggtgaattatgggccggacgtggtggttttcag
caagtagcgagtaccgtattagatagccaacctgatgatgagttatgggccgaaattacg
ttcatgatgtttgatattcctcattctattggtatgtttcctcagcgttattctgactta
tcattattggtgcaaggcctagcaactccccaccttaaattagtagaacaccacccaatt
agcagtgaagatgatttactcaaatcccttgaagagatggcagtgaataaaggcgaaggc
ttaatgctaagaaaactcgattctatttatcgagcgggcagaagtgatgatctgatcaag
ttaaaaaaacactatgatgatgaagcgattattgtgggttataccgatggaaaaggtaaa
tttgaagggatggtcggggcgttaatattgcaaatgccaaatggacaagagtttaagatt
ggcagtggattaagcaatgaagtgcgagaaaacccaccaatattagggcagcaagtgact
tatcgttataatggctttacggacagtggtattcctaagtttgcgcgatatattgcggtt
cgtgaaaaatattaa

DBGET integrated database retrieval system