KEGG   Aliivibrio salmonicida: VSAL_I1858Help
Entry
VSAL_I1858        CDS       T00782                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vsa  Aliivibrio salmonicida
Brite
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VSAL_I1858 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAQ79543
UniProt: B6ENP9
LinkDB All DBs
Structure
PDB: 

Position
1:complement(1993731..1994315)
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWNCLAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKNADGSLAIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDFRNVRPDYMGAFW
SLVNWSFVEENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattaccagctctaccgttcgcaaaagacgcattagaaccacatatctca
gctgagactttagattaccaccacggcaaacaccacaacacttatgtggttaagcttaac
ggtcttatcccagggactgaatttgaaggcaagacgctagaagagatcatcaaaacttct
actggcggtgtttttaacaacgccgctcaaatttggaaccacacgttctactggaactgc
ctagctccaaacgctggcggccaaccaacaggcgctgtcgctgctgcaatcgatgctgca
tttggttctttcgaagaattcaaagcaaaattcacagattcagcaatcaacaactttggt
tcttcttggacttggcttgttaaaaatgctgacggctctctagctatcgttaatacatct
aacgcggcaacaccgctaacagatgaaggtgtaacgccactactaactgttgatctatgg
gaacatgcttactacattgatttccgtaacgttcgtcctgattacatgggtgcgttctgg
tctctagttaactggtctttcgtagaagaaaacctagctaagtaa

DBGET integrated database retrieval system