KEGG   Aliivibrio salmonicida: VSAL_I1941Help
Entry
VSAL_I1941        CDS       T00782                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00240  Pyrimidine metabolism
vsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VSAL_I1941 (tdk)
Enzymes [BR:vsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VSAL_I1941 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: CAQ79626
UniProt: B6EH44
LinkDB All DBs
Position
1:2076233..2076811
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPVIFTAAIDDRYGVGKVSSRIGLDADAH
LFHTDMDMFETIKTLHEAKKIHCVLIDECQFLTKEQVYQLTEVVDKLHIPALCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIADGDQVAIGGNELYVS
VCRSHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaaatgtacttttattactcagcaatgaatgcgggtaaatcaacaacacttctt
caatcgtcttttaattaccaagaacgcggaatgaatcctgtgattttcactgcggctatt
gatgatcgttacggtgtaggaaaagtgagctctcgtattggtctagatgccgatgcgcat
ttatttcatacagacatggatatgttcgaaacgattaaaacgctgcatgaagcaaaaaaa
atacactgtgtattaatcgatgaatgccagtttttgacgaaagagcaagtttaccaatta
acagaagtcgtcgataaattgcatatcccagcgttatgttatgggttacgtactgacttt
ttaggtgagctatttgaaggcagtaaatatttattatcatgggctgataaattggttgag
ttaaaaaccatttgtcattgtggtcgtaaagcgaacatggttattcgtactgatgagcat
ggtgttgctattgctgatggtgatcaagttgctattggtggtaatgaattatatgtatcc
gtttgccgaagccattataaagaagcactaggtaagtaa

DBGET integrated database retrieval system