KEGG   Aliivibrio salmonicida: VSAL_I2032Help
Entry
VSAL_I2032        CDS       T00782                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00250  Alanine, aspartate and glutamate metabolism
vsa00410  beta-Alanine metabolism
vsa00430  Taurine and hypotaurine metabolism
vsa00650  Butanoate metabolism
vsa01100  Metabolic pathways
vsa01110  Biosynthesis of secondary metabolites
vsa01120  Microbial metabolism in diverse environments
vsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VSAL_I2032
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VSAL_I2032
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VSAL_I2032
   00430 Taurine and hypotaurine metabolism
    VSAL_I2032
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VSAL_I2032
Enzymes [BR:vsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VSAL_I2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF5446
Motif
Other DBs
NCBI-ProteinID: CAQ79717
UniProt: B6EHQ6
LinkDB All DBs
Position
1:complement(2178698..2180341)
Genome map
AA seq 547 aa AA seqDB search
MVTDNKTADANLESMLRIFTVPEAPDSTLGKIEQELSQNLNQFLREHIVAEEKPLTEIEK
DFTDSSMPEYPTYVSEHTEHLLETVVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQESAFYERWMHSADHSLGAFCSGGTIANITA
LWVARNRLLQPEGNFKGIAQEGLFAALTHYKYSGLAIFVSERGHYSVKKAADVLGIGQDS
VIPVKTDNNNRICLHDLKLKMAQAKEKNIKPLAIIGVAGTTETGTIDPLRALAEVAKQVN
CHFHVDAAWGGATLMSNQYRYLLDGIDLADSVTIDAHKQLYVPMGAGMVIFKDPELMSSI
QHHAEYILRKGSKDLGRHTLEGSRSGMAMLLYSCFNVISRPGYELLINQSIEKAKYFAEI
IDQQDDFEVITQPELCLLTYRYIPKNVTLALTKANPEQTIEIYDHLDELTKFIQKTQRET
GKSFVSRTRLTPEAYQNMPTIVFRVVLANPLTTKEILHSVLIEQREIAQKSEISLPQLTK
LADSILK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagacaacaaaacggcagatgccaacctagaaagtatgctgcgaatttttact
gttccggaagcgcccgattcgacacttggtaaaatagaacaagaactctctcaaaatcta
aatcagtttttaagagagcatattgttgccgaagaaaagccattaacggaaattgaaaaa
gactttactgactcgtcaatgccagaatatccaacctatgtttctgagcataccgagcat
ttattagagaccgttgtttcacagtccgttcatacttcagcgccaagcttcattggtcac
atgacatccgcattgccttatttcttaatgccactgtcaaagatcatgattgcgttaaac
caaaacttggtgaaaattgaaacctctaaagccttcactccattagagcgccaagtttta
ggtatgttacatcgattgatctacggtcaagaaagcgcattttatgaacgttggatgcac
agtgctgaccactcattaggcgctttttgttctggcgggacaattgcaaacattacggcg
ttatgggtagcacgaaatcgcttattacaaccagaaggcaattttaaaggaattgctcaa
gaagggttatttgcggctttaacgcattacaaatacagtggtttagctatttttgtttca
gaacgtggtcattactctgtaaaaaaagccgctgatgtacttggtatcggtcaggatagc
gttattccagtcaagactgataacaataatcgcatttgtctgcatgatcttaagctaaag
atggctcaagccaaagagaaaaacattaagccattagctatcatcggcgttgcaggtaca
acagaaactggcactatcgatccattacgagctttagctgaagtagcaaaacaagtaaat
tgccatttccacgttgatgccgcttggggcggagcgaccttaatgtcgaaccaataccgt
tatttacttgatggcatcgatttagcggattcagtcaccattgatgcacataagcaactt
tatgttcctatgggtgcaggcatggtcatatttaaagacccagaattgatgtcttctatt
caacatcatgccgagtatattttacgaaaaggttcaaaagatttaggcagacacacatta
gaaggctctcgaagtggtatggcaatgctgctttattcttgttttaatgtaatcagtcga
cctggctatgaattattgatcaatcaaagcattgagaaagcaaaatattttgctgagatt
attgatcaacaagacgattttgaagttattactcagcctgagctttgtttattaacctat
cgatatattccaaagaatgtaacgttagcacttacaaaagcaaatcctgagcaaaccatt
gagatttatgaccacctagatgaactgactaagtttattcaaaaaactcaacgagaaacc
gggaaatcatttgtatctcgaactcgactaacacctgaagcgtatcaaaatatgccgacc
atcgtatttcgagtcgttttagccaatccgttaaccaccaaagagatccttcactctgta
ttaattgagcagagagaaatcgcacaaaaaagcgaaatatcactcccacaattgacgaaa
ttggctgattctattttaaaataa

DBGET integrated database retrieval system