KEGG   Aliivibrio salmonicida: VSAL_I2558Help
Entry
VSAL_I2558        CDS       T00782                                 

Gene name
arcA
Definition
(GenBank) response regulator, aerobic respiration control protein ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VSAL_I2558 (arcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vsa02022]
    VSAL_I2558 (arcA)
Two-component system [BR:vsa02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   VSAL_I2558 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CAQ80242
UniProt: B6EKZ0
LinkDB All DBs
Position
1:2740146..2740865
Genome map
AA seq 239 aa AA seqDB search
MQTPQILIVEDEHVTRNTLKSIFEAEGYNVFEASDGEEMHTVLSEQQLNLVIMDINLPGK
NGLLLARELRERGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLTR
SMNQSTAVEDKKLVERYTFNGWTVEINSRSLVSPSGESYKLPRSEFRALLHFCENPGKIQ
TRADLLKKMTGRELKPHDRTVDVTIRRIRKHFESVTDTPEIIATIHGEGYRFCGDLEEL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccctcagatcctaatcgttgaagatgaacacgttactcgtaatacactaaaa
agcatttttgaagcagaaggctacaatgtattcgaagcaagcgatggtgaagaaatgcac
actgtgctttctgaacaacagcttaatcttgtgattatggacatcaaccttccaggaaaa
aatggccttcttcttgctcgtgaacttcgcgaacgtggtgatatggctcttatgttcctt
acaggtagagacaatgaagttgataagattttaggattagaaatcggtgctgatgattac
atcacaaaaccatttaatcctcgcgagctgactattcgtgcacgtaacttattgactcgt
tcaatgaatcaaagcacagccgttgaagataaaaaactggttgagcgttatacattcaat
ggttggactgttgaaatcaacagccgctctctagttagcccaagcggtgaaagctacaag
cttcctcgctctgaattccgtgccttacttcacttctgtgaaaacccaggtaaaattcag
actcgtgctgacttattgaaaaaaatgacaggccgtgagctaaaacctcatgatcgtact
gttgatgtaactattcgtcgcatccgtaagcattttgaatcagtaacagatactcctgag
attatcgctactattcatggtgaaggttaccgtttttgtggtgatctagaagagttataa

DBGET integrated database retrieval system