KEGG   Aliivibrio salmonicida: VSAL_II0387Help
Entry
VSAL_II0387       CDS       T00782                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00564  Glycerophospholipid metabolism
vsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VSAL_II0387 (glpD)
Enzymes [BR:vsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VSAL_II0387 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAQ81141
UniProt: B6ER11
LinkDB All DBs
Position
2:429697..431244
Genome map
AA seq 515 aa AA seqDB search
MNNGNQTHTTCAVLDLIVVGGGINGAGIAADAAGRGLTVGLYEASDFASATSSASSKLIH
GGLRYLEHYEFRLVSESLAEREVLLAKAPHIAKPMRFRLPHRPFLRPAWMIRAGLFLYDN
LGKRTTLPASHSVNLAASGLLKPEMKKGFEYSDCWVDDARLVILNAMAAEKNGAEVKNYC
RVEKATRVGGLWNVTLFDEQTNTRFERKTKALVNAAGPWVKQFFDDSLEEESPRNIRLVK
GSHIVVPRIHNEEQAYILQNKDNRIVFVIPYMEDFSIIGTTDVEYKGDPSKVEISEDEVN
YLIDVVNQHFVEQIQRDDVVWTYSGVRPLCDDESDSPQAITRDYTLELEQELDQAPLLSI
FGGKLTTYRKLAETAMKMLSPYFMKIGASWTRDVALPGGDFDYPRTQLVNNICSKHTWLA
EKTATRYVNQFGTLVWTLLENMDCEANMGQVFGEGVYQAEIDYLMHHEFSQKAEDVLWRR
TKLGLYLSKEEQVKVADYMNSSITSKVEVKLEQVS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaataatggaaaccaaacacacacaacctgcgctgttttagatttaatcgtagtgggt
ggtggtattaatggtgcaggaattgccgctgatgctgctgggcgaggcttaaccgttggt
ttgtatgaagcatcagattttgcttctgcaacgtcatcagcaagctcaaagttgattcac
ggtggtttacgttatttagaacattatgagtttcgtttagtttcagaatctttagctgag
cgtgaagttctgttagccaaagcaccacatattgccaaaccaatgcgtttccgtttgcct
catcgcccatttttacgtccagcatggatgatccgtgccggtctgttcctttatgataat
ttaggcaaacgcaccacattaccagcaagtcattcggttaatttagcggcgtccggttta
ctaaaacctgagatgaaaaaaggatttgaatattcagattgttgggttgatgatgcgcgt
ttggttattttaaatgccatggccgcagagaaaaatggcgcagaagtgaaaaactattgc
cgcgttgagaaagcgactcgtgtgggggggttatggaatgttactctttttgacgagcaa
acgaacacgcgctttgagcgtaaaaccaaagcactggttaatgcggcgggtccttgggta
aagcagtttttcgatgacagtttagaagaagaatcgcctcgtaatattcgtttagtgaaa
ggctctcatattgtggttcctagaattcacaatgaagagcaagcgtacattctgcaaaat
aaagacaatcgtattgtgtttgttattccttatatggaagacttttctatcattggcaca
accgatgtggaatacaaaggcgacccaagcaaagtcgaaatatcagaagacgaagtaaac
tacttaattgatgtcgttaatcaacattttgttgagcaaattcaacgtgatgatgtagtg
tggacttacagtggtgtacgtccattatgtgatgacgaatctgattcaccacaagcgatt
acgcgtgattacacattagaacttgagcaagaactagatcaagcaccattgctttctatt
tttggtggaaaactaacgacataccgaaaactggctgaaacggcaatgaaaatgctgagc
ccatatttcatgaaaataggtgcgtcgtggacaagagacgtcgcattacctggtggtgat
tttgattaccctcgtacgcaattagtgaataacatttgcagtaaacatacgtggttagca
gagaaaacggcaacacgatacgtgaatcaatttggtaccttagtctggacattgttagaa
aacatggattgtgaagcgaatatgggacaggtattcggtgaaggggtttatcaagctgaa
attgattatttaatgcaccatgagttctcacaaaaagcagaagatgtattgtggagaaga
actaaacttggtctgtatttaagcaaagaagaacaagtaaaagtagctgattatatgaat
agttcaataacatcaaaggttgaagttaaattagaacaagtgagttaa

DBGET integrated database retrieval system