KEGG   Aliivibrio salmonicida: VSAL_II0639Help
Entry
VSAL_II0639       CDS       T00782                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vsa  Aliivibrio salmonicida
Pathway
vsa00473  D-Alanine metabolism
vsa00550  Peptidoglycan biosynthesis
vsa01100  Metabolic pathways
vsa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VSAL_II0639
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VSAL_II0639
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VSAL_II0639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vsa01011]
    VSAL_II0639
Enzymes [BR:vsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VSAL_II0639
Peptidoglycan biosynthesis and degradation proteins [BR:vsa01011]
 Precursor biosynthesis
  Amino acid ligase
   VSAL_II0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp Peptidase_M24_C
Motif
Other DBs
NCBI-ProteinID: CAQ81393
UniProt: B6ERQ9
LinkDB All DBs
Position
2:complement(687846..688877)
Genome map
AA seq 343 aa AA seqDB search
MQLIAPFLFAEDIMTHILLLCGGSGTEHEVSLVSANYIAQQLSELNTFQITHLEIKDGSW
FHIESGLKYELRSDKTLLCNNEATAPVDYVVPCIHGYPGETGDIQSMLDMFSIPYLGCNA
EASTNSFNKITSKLWYDALSIPNTPYLFLTENNQTTHDEALVAFDQWGSLFVKAACQGSS
VGCYHVTSKEQVVEAVNNAFTYSEQVLVEKAVKPRELEVSAYEIDGELYTTLPGEVTAPD
GAFYTYEEKYGSGSHSTTTLDAKNLTEEQIELINKYSRKVFTQMKLKDLSRIDFFLTDEN
EIYLNEVNTFPGMTPISMFPKLLEHNGHCFKTFLQKAILNALK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttaattgcaccttttctttttgcagaagatattatgactcacattcttttactt
tgtggcggtagcggtactgaacatgaagtttcattggtttctgccaattatatagcccaa
caactgtctgaactcaatacatttcaaatcacacatcttgagattaaagatggcagttgg
tttcatattgaatctggtttgaaatatgaattacgctcagacaaaacgttactttgtaat
aatgaagcgacagcccctgttgattatgtagttccctgtatccatggttaccctggtgaa
acaggcgatatccaatcaatgcttgatatgttttcaattccttatttaggttgtaacgca
gaagcaagtacaaacagctttaataagataacatcgaagctttggtacgacgcgttgagt
attccaaatacgccgtatttatttttgactgaaaacaaccaaaccacccatgatgaggca
ttggttgcttttgaccaatggggcagtttgtttgtcaaagccgcatgccaaggttcatct
gttggttgttaccacgtaacgtcaaaagaacaagtagttgaagcggtaaacaatgcattc
acttactcagagcaagtattagtagaaaaagcagtcaaaccaagagaacttgaagtttca
gcttatgaaattgatggcgaactttatactactttacctggtgaagttactgctcctgat
ggtgctttctatacgtatgaagaaaaatatggcagtggtagtcattcaaccacaacatta
gacgctaagaatttaactgaagaacaaatcgagttaatcaataaatacagtcgaaaagta
ttcactcaaatgaaattgaaagacttatctcgtattgatttttttcttaccgatgaaaac
gaaatatacttgaatgaagtgaatacctttccaggtatgacaccaatctcaatgtttcca
aaattgttagaacataatggccattgctttaaaaccttcttgcaaaaagccatactgaac
gcattaaaataa

DBGET integrated database retrieval system