KEGG   Vibrio scophthalmi: VSVS12_00441Help
Entry
VSVS12_00441      CDS       T04650                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
vsc01130  Biosynthesis of antibiotics
vsc01230  Biosynthesis of amino acids
Module
vsc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VSVS12_00441 (aroK)
Enzymes [BR:vsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VSVS12_00441 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 Cytidylate_kin dNK TsaE ABC_tran AAA AAA_16 AAA_22 AAA_17 Ploopntkinase3 APS_kinase CoaE AAA_7 AAA_5 AAA_PrkA AAA_24 RNA_helicase AAA_28 His_biosynth AAA_29 AAA_25 IstB_IS21 RsgA_GTPase AAA_2
Motif
Other DBs
NCBI-ProteinID: ANS84258
UniProt: A0A1B1NKK1
LinkDB All DBs
Position
1:479680..480198
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFVDSDTVIEERTGADIAWVFDVEGEAGFR
DREEKVINDLTEEQGIVLATGGGSIMSKENRNRLSARGIVVYLETTIEKQLARTNRDKKR
PLLQTDSPREVLEALAGERNPLYDEIADYTVRTDDQSAKVVANQIVKMLEES
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttccttgttggcccgatgggcgccggcaaaagtacaatt
ggtagacaccttgctcaacaacttcatatggagtttgttgattcagatactgttattgaa
gaacgcactggtgccgatatcgcatgggtattcgacgtagaaggcgaagctggcttccgc
gatcgtgaagagaaagtgattaacgacctaaccgaagagcaaggcatcgtacttgcaaca
ggtggtggttcgatcatgagtaaagaaaaccgtaaccgtctttctgctcgcggtatcgtt
gtttacctagaaacaactattgaaaaacaacttgcacgtacaaaccgtgacaagaaacgt
cctctgctacagactgacagccctcgtgaggtgctagaagcattagccggtgaacgtaac
ccactatacgatgaaattgcggattacactgtacgtacggatgatcaaagtgcaaaagtg
gtagccaatcagatcgtaaaaatgctagaagagagttaa

DBGET integrated database retrieval system