KEGG   Vibrio scophthalmi: VSVS12_01081Help
Entry
VSVS12_01081      CDS       T04650                                 

Gene name
sod2
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vsc  Vibrio scophthalmi
Brite
Enzymes [BR:vsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VSVS12_01081 (sod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANS84851
UniProt: A0A1B1NMF6
LinkDB All DBs
Position
1:complement(1134124..1134708)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIVKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMGGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaactaccagctcttccttacgcaaaagacgcactagaaccacacatctca
gctgaaacgctagatttccaccacggtaagcaccacaacacttacgttgttaagctaaac
ggtcttatccctggcactgagtttgaaggcaaaacactagaagagatcgttaaaacttct
actggtggcgtattcaacaacgcagctcaaatctggaaccacacgttctactggcactgc
ctagcgccaaacgcaggtggcgaaccaacaggtgctgtggcagacgcaatcaacgcggca
ttcggttctttcgaagaattcaaagcgaagttcactgattctgcaatcaacaactttggt
tcttcttggacttggcttgttaaaaaagctgacggttctctagagatcgttaacacctct
aacgcagcaacaccactaacagaagaaggtacaacacctcttctaacggttgacctgtgg
gaacacgcttactacatcgactaccgcaacgttcgtccagattacatgggcggcttctgg
gcactggttaactgggatttcgtcgcagaaaacctagcaaaataa

DBGET integrated database retrieval system