KEGG   Vibrio scophthalmi: VSVS12_01550Help
Entry
VSVS12_01550      CDS       T04650                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00250  Alanine, aspartate and glutamate metabolism
vsc00410  beta-Alanine metabolism
vsc00430  Taurine and hypotaurine metabolism
vsc00650  Butanoate metabolism
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
vsc01120  Microbial metabolism in diverse environments
vsc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VSVS12_01550 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VSVS12_01550 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VSVS12_01550 (gadB)
   00430 Taurine and hypotaurine metabolism
    VSVS12_01550 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VSVS12_01550 (gadB)
Enzymes [BR:vsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VSVS12_01550 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446
Motif
Other DBs
NCBI-ProteinID: ANS85317
UniProt: A0A1B1NNJ2
LinkDB All DBs
Position
1:complement(1694197..1695819)
Genome map
AA seq 540 aa AA seqDB search
MADVSFESLLRIFTVPEGPDSTLTQIEEELSRNLNKFLREHIVAEEKPLREIEKDFSCAV
IPEQPEFVSEHTQHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALNQNLVKI
ETSKAFTPLERQVLGMLHRLIYSQDHGFYQQWMHSANHSLGAFCSGGTIANITALWVARN
NALRAQGHFRGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGIGQDGLVAVKT
DSNNRICPDDLKLKIKELKDKKIKPFAVIGVAGTTETGNIDPLKAMAAICQAEGCHFHVD
AAWGGATLMSNRYRHLLDGIELADSVTIDAHKQLYIPMGAGMVLFKDPSSMKSIEHHAQY
ILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLINQSIEKARYFADLIEQQAD
FELVSQPELCLLTYRYLPRHVREALEKANPAQRTELNGLLNELTKFVQKRQRENGRSFVS
RTRLNPVHWDDLNTIVFRVVLANPLTTCDILQSVLEEQREIALHGAPSLLEKIESLASKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtaagtttcgaaagtttacttcgaatctttaccgtcccagaaggcccagac
tcaacactgactcaaattgaagaagaactgtctcgtaacttaaataagtttctacgagaa
catattgtggctgaagaaaagcccttacgagaaattgagaaagatttctcctgcgcggtg
atccccgagcagcccgagtttgtttccgaacatacccaacacctgcttgatacgctggtg
tcgcattccgttcatacttctgcaccaagttttattggtcatatgacatccgcattacct
tatttcttaatgccattgtcaaagatcatgatcgcacttaaccaaaacctggttaaaatt
gaaacatcgaaagcctttaccccacttgaacgtcaagtgttgggtatgcttcatcgtctc
atttattcacaagatcatggtttctatcagcaatggatgcacagtgccaaccactcactg
ggcgcattttgctctggtggaaccattgctaacatcacggctctatgggttgcacgtaat
aatgcattgcgcgcacaaggccatttccgcggcgtagaaaaagaaggcctcttcaaagcc
atgaaacactatggttatgaaggtttggctatcttagtctctgaacgcggccattactca
ttgaaaaaagcagccgatgtattagggattggtcaagatggccttgttgcggtaaaaaca
gacagcaacaaccgcatctgccctgatgatctcaagctcaaaatcaaagagctgaaagac
aaaaagatcaaaccattcgctgtcattggcgtcgctggtacaactgaaacgggtaatatc
gatccgctaaaagccatggcggcaatctgccaagcagaaggatgtcacttccacgttgat
gcagcatggggcggtgccactttgatgtctaaccgttaccgtcatctattggatggtatc
gaattggccgactccgtcaccattgacgcacacaaacagctttatattccaatgggtgcc
ggaatggtcttgttcaaagacccaagctcaatgaaatcaatcgagcaccatgcgcaatat
attttgcgtaaaggctcaaaagatctcggcagccatacattagagggttcacgctctggc
atggctatgttggtgtatgctgcaatgcatattattagccgacctggctacgaactgctg
atcaaccaaagcatcgaaaaagcgcgatactttgccgatctcatcgagcagcaagcagac
tttgaactggtttcacagccggaattatgtctgctaacctatcgctatctgccacgccat
gttcgtgaagctctcgaaaaagcaaacccagcacaacgcaccgaacttaacggtctattg
aatgaactcaccaagtttgtgcaaaagcgccaacgtgaaaatggtcgttcatttgtttcc
cgtacgcgcttaaacccggttcattgggacgacttaaacaccatcgtcttccgtgtagta
cttgcaaacccactcactacttgtgacattctacaaagtgtcttagaagaacaacgtgaa
atcgccctacatggtgcgccaagcctactagagaaaattgagtcgcttgccagtaaactc
tga

DBGET integrated database retrieval system