KEGG   Vibrio scophthalmi: VSVS12_01928Help
Entry
VSVS12_01928      CDS       T04650                                 

Definition
(GenBank) ATP-binding/permease protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
vsc  Vibrio scophthalmi
Pathway
vsc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VSVS12_01928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vsc02000]
    VSVS12_01928
Transporters [BR:vsc02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    VSVS12_01928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N ABC_membrane DUF87 AAA_29 AAA_10 AAA_16 MMR_HSR1 AAA_22 RsgA_GTPase NACHT AAA_23 AAA_7 AAA_30 Zeta_toxin FtsK_SpoIIIE AAA_25 Ploopntkinase3 Pox_A32
Motif
Other DBs
NCBI-ProteinID: ANS85694
UniProt: A0A1B1NQ93
LinkDB All DBs
Position
1:2128348..2130084
Genome map
AA seq 578 aa AA seqDB search
MRDLLPYLKLYRKHWFGLTLGMLLALLTVGASIGLLTLSGWFLSAAAVAGLTIARETFNY
MLPGAFVRGCAMGRTAGRWGERVVSHNATFKLLTDLRIFFFKKLAPLVPGKVANLRDADL
LNRLVADIDAMDHVYLRLINPVVVGVFGVAALTAVLYWFDATLGLTLGGILLTLLIVWPI
LFYKLGKRNGSELTQNKADFRITTLDWLQGYSELTLFGAEERYRNAIYSAQEKLLKNQLV
NAHFSGLAQALLMLANGWTLVLMLWLAADGVAGAKPDPMIALFAFATMASVELLMPIAGA
FQHLGKTLTSARRLNEVILAEPEVQFPESPIAHDGLFSVEYRDVSFTYPDGNQPVVEQVN
LHIPAKHRMAIVGQTGSGKSTLIQLLTRYWDVNQGQLLIADKPIQQWSESQLRAAVTVVS
QRVDVLNGTLRDNLILAKPDADDEEISLALHKVGLSKLLQGDTPEKSGLDAWLGDGGRQL
SGGEKRRIGIARALLHNAPILLLDEPTEGLDKQTEQQIMRLFEQHFADKTVLFITHRLVN
LDKMDTVCLIEDGHVIEHGSHHDLLAQKGRYYALNQTL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatttacttccctacttaaaactgtatcgcaaacattggtttggccttacttta
ggtatgctacttgcgctgcttaccgtcggcgcttctatcggtttgctaacgctttccggt
tggttcttatctgcggcagcagtagcaggtttaaccattgcccgtgaaacgttcaactac
atgctgcccggcgcctttgtccgtggctgtgcgatgggtcgaaccgctggtcgttggggt
gagcgcgttgttagccataatgcaacgtttaaactgctcactgatctgcgtattttcttc
tttaagaaacttgcccctcttgtgccgggtaaagtggctaatttacgtgatgctgacctg
cttaaccgcctagtcgctgatattgatgcaatggaccatgtctatctgcgtcttatcaat
ccagttgtggttggtgtgttcggcgttgctgccttaaccgcggttttatattggtttgat
gccacccttggtttaacgcttggcggcatattgctgactcttctcatcgtttggccaatt
ttattctacaaattaggcaaacgtaacggcagtgaactaacgcaaaacaaagcagatttt
cgtattaccacactggattggttacaaggctacagtgagctgaccctgtttggtgctgaa
gagcgctaccgcaatgcgatttactctgcgcaggaaaagctactaaaaaaccaactggtc
aatgcgcacttctctggcttggctcaagcgctattgatgctggcaaatggttggacatta
gttctgatgctttggcttgcagcagatggtgtcgcgggtgccaaacctgatccaatgatt
gctctatttgccttcgcgacgatggccagtgttgaactgctaatgccgattgcaggtgct
ttccagcatttaggtaaaacgctaacctcagctcgtcgccttaacgaagtaatcttagcc
gaaccagaagttcaattcccagaaagcccaatagctcatgatggtctgtttagcgtcgaa
tatcgtgatgttagcttcacctaccctgatggcaaccaacccgttgtggagcaagtgaac
cttcatattccagcaaaacatcgcatggcgattgttggtcaaacgggttcaggaaaatca
accctaatccaactgttgacgcgttactgggatgtgaatcaagggcagttactgatcgcc
gacaaaccgattcaacaatggagtgaatcgcaactgcgtgccgccgttactgtggtcagt
caacgtgttgatgtgctaaatggcacgttacgcgacaacttaatcctggctaaaccggat
gctgatgacgaagaaatcagcctcgccctgcacaaggtcggcttgagcaaactattacaa
ggcgatactcccgagaaaagtggtttagacgcttggcttggtgatggtggtcgtcagctt
tctggtggtgaaaagcgccgtattggtattgctcgtgcattgctgcataacgcgccaatc
ctactgctagatgaaccaactgaaggtttggataaacagactgagcaacaaatcatgcgc
ctgtttgagcagcacttcgctgataaaaccgtgctgtttattacccaccgtttggtcaat
ctcgacaagatggatacggtgtgtctgattgaagatggtcacgttatcgagcacggttcg
catcatgatttattagcgcaaaaaggccgttattacgcgcttaatcaaacgctgtaa

DBGET integrated database retrieval system