KEGG   Vibrio scophthalmi: VSVS12_02201Help
Entry
VSVS12_02201      CDS       T04650                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00240  Pyrimidine metabolism
vsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VSVS12_02201
Enzymes [BR:vsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VSVS12_02201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: ANS85962
UniProt: A0A1B1NQE1
LinkDB All DBs
Position
1:complement(2417710..2418288)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPVIFTAALDDRYGIGKVSSRIGLQSDAF
LFKPETDLFKAIETLNSEEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGNAIAQGDQVAIGGNDRYVS
VCRQHYKEALGQ
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtacttctattactcggcaatgaatgcgggtaaatctacgacgcttctt
caatcttcatttaactaccaagagcgtggcatgaacccagtgattttcactgcggcatta
gatgatcgttacggtattggtaaggtgagttcgcgtattggtttgcagtcagatgctttt
ctattcaaaccagaaacagatttgtttaaggcgattgaaacgcttaatagcgaagaaaaa
cgtcactgtattttgattgatgaatgtcagttcttatcgaaagagcaggtatatcagcta
acggaagtggtcgataaactgcatattcctgttttatgctacggccttcgtactgatttt
ctgggtgagctatttgaaggtagtaagtatctactatcgtgggcagataagctggtagag
cttaaaacgatttgtcattgcggtcgtaaagcaaacatggtgattcgtactgacgagcat
ggcaatgcgattgctcaaggtgatcaagtggcgattggtggtaatgaccgttatgtttcg
gtttgccgtcagcactataaagaagcattaggtcagtaa

DBGET integrated database retrieval system