KEGG   Vibrio scophthalmi: VSVS12_02366Help
Entry
VSVS12_02366      CDS       T04650                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase (quinone)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00020  Citrate cycle (TCA cycle)
vsc00190  Oxidative phosphorylation
vsc00650  Butanoate metabolism
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
vsc01120  Microbial metabolism in diverse environments
vsc01130  Biosynthesis of antibiotics
vsc01200  Carbon metabolism
Module
vsc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vsc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VSVS12_02366 (sdhB)
   00650 Butanoate metabolism
    VSVS12_02366 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VSVS12_02366 (sdhB)
Enzymes [BR:vsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VSVS12_02366 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     VSVS12_02366 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ANS86127
UniProt: A0A1B1NQT6
LinkDB All DBs
Position
1:complement(2594583..2595296)
Genome map
AA seq 237 aa AA seqDB search
MMKMNFSLYRYNPDVDDKPYMKDYILEVEEGSDMMLLDALILLKEQDPTISFRRSCREGV
CGSDGLNMNGKNGLACITPLSALAGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFL
QTEGALPPSRENLQTPDERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRW
LIDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKTMLVNRSV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgaacttctctttgtatcgttacaatccagatgttgacgataagccgtac
atgaaagactacattcttgaggtagaagaaggctcagacatgatgcttttggatgcgctg
attctactcaaagaacaagatccaaccatttcgttccgtcgctcatgtcgtgaaggtgtg
tgtggttccgatggtttgaatatgaacggaaaaaatggtcttgcttgtattacgccatta
tctgcgcttgccggagataagatagtgattcgtccgctgcctggcctacctgtggttcgt
gacctgattgttgatatgactcagttctacgataactacgcgaaagttaagccattcttg
cagacggaaggggccctaccaccatcgcgtgagaatttacaaacacccgatgagcgtgcc
catcttgatggtttatatgagtgcatcatgtgtgcatgttgtaccacttcgtgcccatct
ttctggtggaatccggataaatttattggcccagctggcttattagcggcgtaccgttgg
ctaattgatagtcgtgatactgcaacagatgagagattgtccgatctcgacgacgctttt
agtgtttttcgttgccatggcataatgaattgtgtaagtgtttgtcctaagggattaaat
ccgaccaaagcaattggccatatcaagacgatgctggtcaatcgctcagtgtaa

DBGET integrated database retrieval system