KEGG   Vibrio scophthalmi: VSVS12_02367Help
Entry
VSVS12_02367      CDS       T04650                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase (quinone)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vsc  Vibrio scophthalmi
Pathway
vsc00020  Citrate cycle (TCA cycle)
vsc00190  Oxidative phosphorylation
vsc00650  Butanoate metabolism
vsc01100  Metabolic pathways
vsc01110  Biosynthesis of secondary metabolites
vsc01120  Microbial metabolism in diverse environments
vsc01130  Biosynthesis of antibiotics
vsc01200  Carbon metabolism
Module
vsc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vsc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vsc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VSVS12_02367 (sdhA)
   00650 Butanoate metabolism
    VSVS12_02367 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VSVS12_02367 (sdhA)
Enzymes [BR:vsc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VSVS12_02367 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     VSVS12_02367 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like BEX Thi4 FAD_binding_3 DAO Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ANS86128
UniProt: A0A1B1NR13
LinkDB All DBs
Position
1:complement(2595307..2597073)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDYIGDQDAIEYMCKNGPESVIELEKMGLPFSRFDNGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNIKHKTTVFSEWYALDLVKNEDGAILGC
TALCMETGEVCYFKSKATILATGGAGRIYASTTNAHINTGDGVGMAIRAGVPMQDIEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKETLESRLPGVCELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQDDAGNDVEIPGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
EVLDKQAEAKPATDADIERSLERYNRWENSTDGEDPAQIRKDLQQCMQNNFSVFREGDAM
AKGLEELKVIRERLKNAHLADKSTEFNTQRIECLELENLMETAYATAVAANFRTESRGAH
ARFDFPDRDDEQWLCHSIYNPETEAMSKRGVNMEPVHREAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattccagttcgtgaattcgatgccgtagtaatcggcgcaggtggtgcgggcatg
cgtgctgcactgcaaatctctgagcagggcctttcatgtgcgctgctgtctaaagttttc
ccaacccgttctcatacggtatctgcccaaggtggtattacggttgcgttaggtaatgcg
cacgaagaccattgggaacagcatatgtacgataccgtcaaaggttctgattacatcggt
gaccaagatgcgatcgaatacatgtgtaaaaacggtcctgaatcggtgattgaacttgag
aagatgggcctacctttttctcgttttgataacggtacaatctatcaacgtccgtttggt
ggtcagtcgaagaactttggtggtgaacaagccgctcgaaccgctgcggcggctgaccgt
acaggtcatgcgttattgcatactttgtaccaacaaaatatcaaacataaaacgaccgta
ttttcagaatggtatgcgctagatttagtcaaaaatgaagacggcgccattctcggttgt
acagcactttgcatggaaacgggtgaagtgtgctatttcaaatcgaaagcaacgattctg
gccacgggtggtgctgggcgtatttacgcatcaaccactaatgcgcacatcaacactggt
gatggtgttggtatggcaattcgtgctggcgtaccgatgcaagatattgaaatgtggcag
ttccacccaaccggtatcgctggcgcaggtgtactagtaacggaaggttgtcgtggtgaa
ggtggttaccttcttaataaagatggcgaacgtttcatggagcgttatgcacctaatgcg
aaagacttagctggtcgtgacgtggttgctcgctcaatgatgattgaaattcgtgaaggt
cgtggttgtgatggcccatggggtccacacattaaactgaagctggatcacttgggtaaa
gaaacattggaatcgcgtctgcctggcgtatgtgagttgtcacgtaccttcgcccacgtt
gatccggtgaaagaaccaatccctgtgataccaacttgtcactacatgatgggcggcgtg
ccaacacaggtgtctggtcaagcgattaagcaagacgatgccggtaatgacgttgaaatc
ccaggtctatttgcttgtggtgaaattgcttctgtatcggtacacggcgctaaccgttta
ggcggcaactcattgcttgaccttgtggtatttggtcgcgcgacgggtctacaccttggt
gaagtgctggataagcaagctgaggcgaaacctgcaacggatgcggatattgagcgttca
cttgagcgttacaatcgttgggaaaacagtaccgacggtgaagaccctgctcaaattcgt
aaagacctacagcagtgcatgcaaaacaacttctcggtattccgtgaaggcgatgcaatg
gccaaaggtcttgaagagctaaaagtaattcgtgagcgtttgaaaaatgcacaccttgcc
gataagtcgacagaatttaacactcaacgtatcgagtgccttgagttggaaaacttaatg
gaaacggcttacgcgactgcggtggctgcaaatttccgtacggaaagtcgtggcgctcat
gctcgctttgatttccctgatagggatgatgagcaatggctatgtcattcgatttacaac
cctgagacagaagcaatgtcgaagcgtggtgtgaatatggagcctgttcatcgtgaagct
ttcccgccgaaagctcgtacatactaa

DBGET integrated database retrieval system