KEGG   Vibrio scophthalmi: VSVS12_03112Help
Entry
VSVS12_03112      CDS       T04650                                 

Gene name
sod1
Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vsc  Vibrio scophthalmi
Brite
Enzymes [BR:vsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VSVS12_03112 (sod1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANS86821
UniProt: A0A1B1NT58
LinkDB All DBs
Position
2:106399..106911
Genome map
AA seq 170 aa AA seqDB search
MKYKLLLAALCVTSTGVLAEELSVEMIDLNSGNSAGTVVITESEYGTVFTPQLTGLTAGL
HGFHVHSNPSCDSSEKNGKTIIGGAAGGHYDPANTGKHGKPWTTDNHLGDLPALYVDMDG
NANQPVLAPRIKLADLDGRALMIHAGGDNHADHPAPLGGGGARMVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaactattacttgctgctttatgtgtgacttctactggtgtattagcggaa
gaacttagcgttgaaatgattgacttaaatagcggcaattctgctggtacggttgtcatc
acagaaagtgaatacggcaccgtatttacaccacaactaacaggcttaacggctggatta
catggcttccatgtccactccaacccatcctgtgacagctcggagaaaaatggcaaaacc
atcattggtggtgccgcgggtgggcactatgatccggcgaataccggtaaacatggtaaa
ccttggacaacggataaccatctaggtgatttacccgcgctttacgttgatatggatggc
aatgccaatcaaccggtattggcacctcgaattaaactggccgatctcgatggccgcgct
ttaatgattcacgctggcggtgataaccatgccgatcacccagcgccactcggcggtggc
ggcgctcgcatggtgtgtggtgtgattaaataa

DBGET integrated database retrieval system