KEGG   Vibrio mediterranei: BSZ05_01250Help
Entry
BSZ05_01250       CDS       T04936                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vsh  Vibrio mediterranei
Brite
Enzymes [BR:vsh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BSZ05_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASI88549
UniProt: A0A2C9P6X1
LinkDB All DBs
Position
1:278274..278858
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIVKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLDIVNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWAFVEENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaactaccagcacttccttacgcaaaagatgctctagaaccacatatctca
gcagaaactctggactaccatcacggtaaacaccacaacacttacgttgttaaactaaac
ggcctaattccgggtactgagtttgaaggcaaaacactagaagagatcgttaagacttca
actggcggtgttttcaacaacgcagcccagatttggaaccacacgttctactggcactgt
ctagcgccaaacgctggcggcgaaccaacaggtgcggttgctgatgcaatcaacgctgca
ttcggctcgttcgaagagttcaaagctaagttcactgattcagcaatcaacaacttcggt
tcttcatggacttggttagttaagaaagctgacggttctctagatatcgtgaacacttca
aacgctgcgactccactaacagaagaaggtgtgactccactactaactgtagacctgtgg
gaacatgcttactacatcgattaccgtaaccttcgtccagactacatgaacggtttctgg
gctctagttaactgggcattcgtagaagaaaacctagctaaataa

DBGET integrated database retrieval system