KEGG   Vibrio mediterranei: BSZ05_03785Help
Entry
BSZ05_03785       CDS       T04936                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSZ05_03785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vsh01003]
    BSZ05_03785
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vsh01011]
    BSZ05_03785
Enzymes [BR:vsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BSZ05_03785
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSZ05_03785
Glycosyltransferases [BR:vsh01003]
 Polysaccharide
  Bacterial polysaccharide
   BSZ05_03785
Peptidoglycan biosynthesis and degradation proteins [BR:vsh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BSZ05_03785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ASI89018
UniProt: A0A2C9P8H5
LinkDB All DBs
Position
1:complement(843163..845553)
Genome map
AA seq 796 aa AA seqDB search
MTVTKKLAPSGKKPAPRKTTTKSAPKSKAKSSKPKRKPSRKKPKQGWGKRLLSIGWKLAL
IGVVALGAVFYYLDQVVKERFEGNLFELPTVVYARVLNLSVGDNITIAQLRNELDVLNYR
KVSQPRHPGEYSSSSTKIELIRRPFEFADGPEPDRHVMLYFNDGTLSRIQSLEKKGDLGF
LRIEPKMLGMLEKKADEQRLFLRRDQFPEIMIDALLATEDRDFYQHDGISPTAIARAFFA
NIRAGRTVQGGSTLTQQLAKNLFLTSDRTLWRKVREVFIALILDYRYSKDQILEAYLNEV
YLGQSRGEAIHGFGLASRLYFGQPLQELRIDQLALLVGMVKGPSYYNPIRHPERAKQRRD
LVLRLMMDQNMLTGREFEMAASRELDLQNNPQIASRQPAYFQQLNRELNSKLGDKLRGGK
GIRIYTSLDPVSQDKLEKAIAKRVPQLEKTSGKGLEAAAVAVDRNTGEIRAMVGGKRTGY
SGFNRALNASRPIGSLVKPAVYLTALEQPQSYDLASTLEDTPITLKGSQGNVWQPRNYDR
KFRGDVPLYQALAKSLNVPTVRLGMSLGIKPVSETLVRLGVDANEIRPVPSMFLGSLSLT
PYQVAQMFQTIANSGRQAELSALRSVVTVDGEVLYRSLPKAQQKVPQQAAWLTTFAMKKG
VAEGTGRYLNSQFAWAALAGKTGTSNDTRDSWFVGVDGREVTTIWVGRDDNKSTKLTGSS
GALRVYSDYLKARIPEKLTLPWPKNISMIGFSKQRSGALELDCGSQFELPVWDEGGKLKA
SCDNQPKQWIKNLFDW
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaacgaaaaagttggcacctagtggtaaaaagccagcaccaagaaagaccacc
acaaaatcggctcctaaatcgaaagccaaaagcagcaaacctaagcgtaaaccgagccgg
aaaaaaccgaaacaagggtgggggaaacgtctgctctcaatcggttggaaactagctctg
attggcgtggtcgcccttggcgcggtgttttattatctcgatcaagtggttaaagagcgc
tttgaaggtaatttattcgagttgccaacagtggtttacgctcgtgtgctcaatctgtct
gtcggcgacaatattacgatagctcagttacgtaatgaactggacgtattgaactatcgt
aaggtatctcaaccgcgccatcctggagagtactcctcgtcttccaccaagatagaactg
attcgccgtcccttcgaatttgccgacggtccagaacccgatcgtcatgtgatgttgtat
tttaacgatgggacattgtctagaattcaatcgttggaaaagaaaggcgatcttggcttt
ctaagaattgaacctaagatgcttgggatgctcgagaaaaaagccgatgaacaacgcttg
tttttaaggcgtgatcaatttccagaaatcatgatcgacgcgttattagcaacggaagat
cgtgatttttaccaacatgatggcatctctcctactgccatagcacgtgcgttttttgct
aacattcgtgctggccgcacggtacaagggggcagtacgttaacacaacagttggctaaa
aacctgttcctcaccagtgatagaaccttatggcgtaaagtaagagaagtgtttatcgca
ctcattcttgactatcgctatagcaaagaccaaatcttagaagcatatttaaatgaagtt
taccttggccaaagccgcggtgaggctattcatggttttgggctagcgtctcgtttgtat
tttggtcagccattacaagagttgagaattgaccagcttgcgttattggtgggtatggta
aaagggccatcgtactacaaccctattcgtcatccagaacgagctaagcagcgcagagac
ttagtgctgcgtttaatgatggatcagaacatgctgactggacgtgagtttgaaatggca
gcctctcgtgaactcgacttgcagaacaatccacaaattgcgagccgccaaccagcgtat
tttcagcagcttaaccgtgagctgaatagcaagctaggcgataagctacgtggaggcaaa
ggcattcgaatctacacctctctggatcctgtttcacaggacaagttagaaaaggccatt
gctaagcgggtacctcagttagagaaaacatccggtaaaggtcttgaagcggctgccgtc
gcggtggacagaaatactggcgagatccgagctatggtgggcggtaagcgtactggttac
agtggtttcaaccgagcgttgaatgcgagtaggccaattggttcgttagtcaagcctgcg
gtctatcttactgcgttggaacagccgcagagctatgatttggcatcgacacttgaagac
actccgataactttgaaaggcagtcaaggtaatgtatggcagccacgaaactacgaccgt
aagttccgtggtgatgtgccgctctatcaagcgcttgcaaaatcccttaatgtcccgact
gtgcgcttgggtatgtctctcggcattaaaccggtttccgagacattagtgcgcttaggt
gtagatgcgaatgagatcaggcctgtaccatccatgttccttggttcgctgtcgttgacg
ccgtatcaagtggctcagatgttccaaactatcgccaactctggacgacaagccgagcta
tcggctttacgctcagtcgttactgtggacggagaggtgctttatcgatctctacctaaa
gcgcagcagaaggtccctcaacaagctgcatggcttaccacctttgcgatgaaaaaaggg
gtagctgaaggaacgggacgttacctgaatagtcagtttgcatgggcagcactggcagga
aaaacaggtactagtaatgatactcgtgatagttggtttgttggtgttgatggacgagag
gtgacgacaatttgggttgggcgtgacgataacaagtcgactaaactcacaggctcaagc
ggtgcgttgcgagtgtattcagactatttgaaagctcgaattccagagaagttaacattg
ccttggcctaaaaacatcagcatgattggtttctcaaagcagcgtagtggtgcactggag
cttgattgcggaagccaatttgaattacccgtctgggatgaaggtggaaaactgaaagct
tcctgtgataaccaacccaaacagtggataaaaaacctatttgactggtga

DBGET integrated database retrieval system