KEGG   Vibrio shilonii: BSZ05_11365Help
Entry
BSZ05_11365       CDS       T04936                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vsh  Vibrio shilonii
Pathway
vsh00250  Alanine, aspartate and glutamate metabolism
vsh00410  beta-Alanine metabolism
vsh00430  Taurine and hypotaurine metabolism
vsh00650  Butanoate metabolism
vsh01100  Metabolic pathways
vsh01110  Biosynthesis of secondary metabolites
vsh01120  Microbial metabolism in diverse environments
vsh02024  Quorum sensing
Module
vsh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSZ05_11365
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSZ05_11365
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSZ05_11365
   00430 Taurine and hypotaurine metabolism
    BSZ05_11365
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSZ05_11365
Enzymes [BR:vsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSZ05_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ASI90318
UniProt: A0A2C9PC97
LinkDB All DBs
Position
1:2404744..2406138
Genome map
AA seq 464 aa AA seqDB search
MPLHKKSAVRGSMLDDVYSSKDLSVVMPKYRIPENEHAPEHAYQVVHDELMLDGNSRQNL
ATFCQTWVEDEVHQLMDECIDKNMIDKDEYPQTAEIESRCVHMLADLWHAPDAENPMGCS
TTGSSEAAMLGGMALKWAWREKMKKQGKPTDKPNLICGPVQVCWHKFARYWDIELREIPM
EGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHEALDKLQEETGLDIPIHV
DGASGAFLAPFCDPDLEWDFRLPRVKSINASGHKFGLSPLGVGWVVWRDADALHEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGKEGYKKIHDACYETARYIAKEVEKMGM
FEIIYDGHGGIPALSWSIKKGANPGFNLYDLSDRIRSRGWQIAAYAMPADRQDLVIMRIL
VRHGFSRDMADLLISDLQHCVDFFDKHPVVNGSDADESSNFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcataaaaagtcagctgttcgtggttcaatgttagatgatgtttactcttcc
aaagatttgtcagtggttatgcccaagtatcgaatccctgagaatgagcacgcacctgaa
catgcctatcaagttgttcacgatgaacttatgctagacggtaactcgcgtcagaactta
gcgacattttgtcaaacatgggtagaagatgaagttcatcaattgatggatgaatgcatc
gataagaacatgattgataaagatgagtacccacaaacggccgagatcgaatcgcgttgt
gttcatatgttagcggatctttggcatgcgccagatgcagagaacccaatgggttgttca
acgacggggtcgagtgaagctgcgatgcttggtgggatggcattaaagtgggcttggcgc
gaaaaaatgaagaagcaaggcaaacctaccgacaaaccaaatcttatttgtggcccagta
caggtttgttggcataagtttgcgcgctattgggatattgaacttcgtgagattccaatg
gaaggtgatcgccttatcatgacacctgaagaagtgatcaaacgttgtgacgaaaacact
attggtgtagtgccgactctcggtgtgacgttcacatgccagtatgagccagtaaaagcg
gttcatgaagctctagataagcttcaagaagaaacaggcttagatattccgattcacgtt
gatggcgccagtggtgcgtttttagcgcctttctgtgaccctgatttagaatgggacttc
cgcttgcctcgtgttaaatcgattaatgcttccggccacaaatttgggctttcgccatta
ggtgtgggttgggtcgtgtggcgtgatgctgatgcgttgcatgaggatttgatcttcaat
gtaaactatcttggcggtaacatgccgacatttgcattgaacttctctcgcccaggggga
caaatcgttgcgcagtactacaacttcttaagattgggtaaagaaggctataaaaagatt
catgatgcatgctacgaaacagcacgctacattgccaaagaagttgagaagatgggcatg
tttgaaatcatttacgatggccacggtggtattccggcactaagttggtctatcaagaaa
ggtgcaaacccaggcttcaacctttatgacttatcggatcgcattcgatctcgtggttgg
cagattgcagcgtatgcaatgcctgcggatcgccaagatctggttattatgcgtattctc
gtacgtcacggctttagtcgagacatggcggacttgctgatttctgacttgcaacattgt
gtcgatttctttgataagcacccagtggttaacggcagtgatgccgacgagtcaagcaac
tttaaccacggttaa

DBGET integrated database retrieval system