KEGG   Vibrio shilonii: BSZ05_15960Help
Entry
BSZ05_15960       CDS       T04936                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vsh  Vibrio shilonii
Pathway
vsh00250  Alanine, aspartate and glutamate metabolism
vsh00410  beta-Alanine metabolism
vsh00430  Taurine and hypotaurine metabolism
vsh00650  Butanoate metabolism
vsh01100  Metabolic pathways
vsh01110  Biosynthesis of secondary metabolites
vsh01120  Microbial metabolism in diverse environments
vsh02024  Quorum sensing
Module
vsh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSZ05_15960
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSZ05_15960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSZ05_15960
   00430 Taurine and hypotaurine metabolism
    BSZ05_15960
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSZ05_15960
Enzymes [BR:vsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BSZ05_15960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446
Motif
Other DBs
NCBI-ProteinID: ASI91177
UniProt: A0A2C9PG35
LinkDB All DBs
Position
1:3420728..3422386
Genome map
AA seq 552 aa AA seqDB search
MVSEQKIADVSFESLLRIFTIPEGPDSTLTQIEEGLSKNLNQFLREHIVAEEKPLHEIEK
DFSSAVIPEQPAFVSDHTEHLLDTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHKLIYSESDPFYSRWMHSANHSLGAFCSGGTIANITA
LWVARNNALKAQGDFLGVEKEGLFKAMKHYGYEGLAVLVSERGHYSLKKAADVLGIGQQG
LVAVKTDSHNRICPEDLKAKFAQLKEDKIKPFAVIGVAGTTETGNVDPLREIAQICQQES
CHFHVDAAWGGATLMSAKYRSLLDGVELADSVTIDAHKQLYIPMGAGMVLFKQPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLINQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYVPKYVRNALASASTEQTTEIHNLLNELTKVIQKKQRET
GLSFVSRTQLNPIQWTLRDTIVFRVVLANPLTTTDVLSSVLEEQRDIAKTAPNLMARLEQ
VSHEILQTKNQK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgagcagaaaattgctgatgtcagcttcgaaagccttcttcgaatcttcact
atccctgaaggaccagattcaactctgacccaaatcgaagaaggattgtccaagaactta
aaccagtttttgcgcgaacatatagtggcagaagaaaagcctttacatgaaattgaaaag
gacttttctagtgctgttattccagaacaaccagcgtttgtttcggaccatactgaacac
cttcttgatacgcttgtatcgcactcggtacacacctcttcaccaagctttatcggtcat
atgacctcggccttgccttatttcttgatgccgttgtcaaaaattatgatcgcgttaaat
cagaacttggtaaagattgaaacctccaaagcattcacgcctctagaacgccaagttctg
ggtatgctccataaactgatttatagtgagtccgaccctttttatagtcgatggatgcac
agtgctaaccattctcttggtgcattttgctcggggggcaccattgccaatatcaccgca
ctttgggtggcacgcaacaacgctttaaaagcgcaaggtgatttccttggtgtagaaaaa
gaagggttgtttaaagcaatgaagcattacggttatgaaggtctagccgtgcttgtctct
gaacgtgggcattattctctaaaaaaagccgcagacgttctgggcattggtcaacaaggt
ctagttgcagttaaaacggatagtcacaaccgaatctgccctgaagatctaaaagccaaa
tttgctcagctcaaagaagacaaaattaaaccttttgcggtcattggcgttgcagggaca
accgaaacaggtaacgttgatccattaagagaaatcgctcaaatctgccaacaagagtct
tgtcactttcacgttgatgcggcatggggcggcgctactttgatgtcagctaaatatcgc
tctctactagatggtgtggaactggcggattcagtgacaattgatgcgcataagcagctt
tatatccctatgggtgcgggtatggtgttgtttaagcaaccagatgccatgaagagcatt
gagcaccacgctcagtatattttgcgcaaagggtcgaaagacttaggcagtcacacgtta
gaaggttcacgctcaggcatggcaatgctcgtttatgccgcaatgcatattattagccgt
ccaggttatgagctgttgatcaatcaaagcatagagaaagctcgttactttgctgacctc
attaaacaacaagacgatttcgagcttgtaagcgaaccagaattgtgtctcctgacctat
cgctacgttccaaaatatgtccgtaatgcactggctagtgcttcaaccgagcagacaacc
gagatccataacttgctaaatgaactgaccaaagtcattcagaaaaaacagcgagaaact
gggctctcctttgtatctcgcacacaacttaatccaattcaatggacactgcgcgacact
attgtgtttagggtcgttttagccaaccctttaactacaacggatgtattaagttcagtg
cttgaagaacaaagagatattgctaaaacggcgcctaacttaatggcaagacttgagcaa
gtctctcacgagatcctccaaacaaaaaaccaaaaatga

DBGET integrated database retrieval system