KEGG   Vibrio mediterranei: BSZ05_17725Help
Entry
BSZ05_17725       CDS       T04936                                 

Definition
(GenBank) transcriptional regulator
Organism
vsh  Vibrio mediterranei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg
Motif
Other DBs
NCBI-ProteinID: ASI91689
UniProt: A0A241T8N2
LinkDB All DBs
Position
2:complement(215709..216425)
Genome map
AA seq 238 aa AA seqDB search
MGRSFEVRKASMAKTQGAKIKVYSKYGKEIYVAAKNGGADPEMNLSLKHLIAKAKKDQVP
AHVIDKALDKASGGGGEDYQPARYEGFGPGGVSVIVDCLTDNGNRTFQDVRQCFVKTGAK
IGSPGTVAHMFDHQAVFQFTGDDEEAVLEALMMADVDVTDIELEDGVITVFAPHTEFFKA
KTALNAEYPDLTVDVEEITFVPQTHTAIAGEDAEKFQKFLDMLDDCDDVQQVYHNAEQ
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaagttttgaagtgcgcaaggcctcaatggccaagactcagggcgcgaaaatt
aaagtttattccaagtatggtaaagagatctatgtagctgctaagaacggtggtgcagat
ccagaaatgaacctttcacttaagcacctgattgctaaagctaaaaaggatcaagttcct
gctcacgttatcgataaagcactagacaaagctagcggtggtggtggtgaagattaccag
cctgcacgttacgaagggtttggtcctggtggcgttagtgtcatcgttgactgtctaaca
gataacggcaaccgtactttccaagatgttcgtcaatgctttgttaagactggcgcaaag
attggtagccctggtactgtggctcacatgttcgatcaccaagcggtgttccagttcaca
ggtgacgacgaagaagcggtgcttgaagctctgatgatggcagatgttgatgtaactgat
atcgagcttgaagatggcgtcatcacagtatttgcaccacatactgagttcttcaaagcg
aaaacggcattgaatgcagaatacccagacctaacggttgatgtagaagaaattacgttt
gtaccgcaaactcatactgcaattgctggcgaagatgctgagaaattccaaaaattcctc
gacatgctagatgactgcgatgatgttcagcaggtttaccataacgcagagcaataa

DBGET integrated database retrieval system