KEGG   Vibrio mediterranei: BSZ05_18080Help
Entry
BSZ05_18080       CDS       T04936                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00052  Galactose metabolism
vsh00500  Starch and sucrose metabolism
vsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSZ05_18080
   00500 Starch and sucrose metabolism
    BSZ05_18080
Enzymes [BR:vsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BSZ05_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: ASI91754
UniProt: A0A241T9F3
LinkDB All DBs
Position
2:290009..291532
Genome map
AA seq 507 aa AA seqDB search
MAFDKKKHQAIIDQVEDYIAEHKETIKQHHWREHYHYQAPVGWINDPHGLIQYEGKYHLF
YQHHPYSGKWGTMHWGHAVSEDLINWETLPEALAPSEEYDGWDGGGIFTGSAVNNDGVMT
LFYTGCAQARQVQCMATSTDGINFDKYDGNPILSDPPEGINLHDFRDPKVWKHDGLWYMV
TGVTDGVSDLINASNYETNGFGKVCLHRSENLTDWEFVGYCVESLGELGTMLECPNIFKL
GDKHVLMYSPMGMQQRQVVYLVGDLDYQTGKFHWSTMGSLDWGFDYYAPQVFDDENGRTL
IQAWIGSWPFMPWCDGTYDTSELGWYGSITLAREVSLCHDGKLKFTPVQEVEKLRHSPKR
HSQVLLNDGEKYAFEAGDNVHCEIIADIDLAASDCESVVFEIRSKGEQKTLIELDLKKGE
LAFDRTQSGSRSALRRTCPLECASKDRANIRIFMDSISVEMFTDGGRTVMTNNIFSNEDS
TGLYVYAKNGHAKIDTLKTFGMKNVAE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtggcattcgacaagaagaagcatcaggcaattattgatcaagttgaagattacatcgct
gagcataaagagacgattaaacaacaccactggcgtgaacattaccactaccaagcacca
gttggttggatcaacgacccacatggattgatccaatacgaaggcaagtatcacctgttt
taccagcatcacccatatagtggtaaatggggcactatgcattggggtcatgccgttagt
gaagatttgatcaactgggaaacattgccagaagctctagctccaagtgaagaatatgac
ggttgggatggaggcggtatctttacgggtagtgcggttaataatgatggtgtcatgact
cttttctacacaggttgcgcgcaagctaggcaagttcagtgtatggcaacctcaacagat
ggtattaactttgacaaatacgatggcaacccaattctgtctgatccaccagaagggatt
aacctacatgacttccgtgatcctaaagtttggaaacatgacggattgtggtacatggtg
acaggtgtaacagacggagtcagcgatcttattaacgcatcaaactatgaaacaaacggt
tttggtaaggtttgtttgcatcgctctgaaaacctgactgattgggagtttgtgggctac
tgcgtagaaagccttggtgagctcggaaccatgcttgagtgtcccaatatattcaagctt
ggtgacaagcacgtcttaatgtactccccaatgggcatgcagcagcgtcaagtagtgtat
ttggttggtgatcttgattaccaaacaggtaaattccactggtcgacgatgggctcatta
gattggggctttgattactatgctccgcaagtgtttgatgacgagaatggtcgaactttg
atccaagcttggattggttcgtggccgtttatgccttggtgtgatggtacgtacgatacg
agcgaactcggttggtatggcagtattacactggctcgtgaagtatcactttgccacgat
ggaaagctgaaatttacccctgtacaagaagtagagaaactacgtcactcaccgaaacga
catagccaagttttacttaatgatggcgagaagtatgcgtttgaggctggtgacaatgtt
cactgtgagattattgcagatatcgacttagctgcaagtgattgtgagagcgtagtattt
gaaattcgcagcaaaggcgaacagaagacactaattgaactggatctgaaaaagggcgaa
ctggcgtttgaccgcacccaatctggcagtcgttctgctttgcgcagaacgtgtccactg
gagtgtgctagtaaagatcgtgcgaatattcgtattttcatggatagtatttcggttgaa
atgtttacagacggcggtcgtacggtaatgaccaacaacattttctccaatgaagacagc
actggtctatatgtgtatgcgaaaaatggtcacgctaagatcgatacactgaaaaccttc
ggtatgaaaaacgtcgcagagtag

DBGET integrated database retrieval system