KEGG   Vibrio mediterranei: BSZ05_20580
Entry
BSZ05_20580       CDS       T04936                                 

Definition
(GenBank) glucohydrolase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00052  Galactose metabolism
vsh00500  Starch and sucrose metabolism
vsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSZ05_20580
   00500 Starch and sucrose metabolism
    BSZ05_20580
Enzymes [BR:vsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     BSZ05_20580
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C Glyco_hydro_42C Alpha-amylase_C hDGE_amylase Cyc-maltodext_C DUF3459
Other DBs
NCBI-ProteinID: ASI92206
UniProt: A0A241TAB7
LinkDB
Position
2:858343..859971
AA seq 542 aa
MEKRWWHNSVVYQIYPRSFCDSNGDGIGDLNGIRSKLDYLTELGVDVIWLSPVYQSPMDD
NGYDISDYQAIAPEFGTMEDMDALLAEAKERGIKIVMDLVVNHTSDEHEWFKRACESKTS
PYRDYYVWRDAKPDGSAPSDMGSIFGGSAWEWHEATQQYYLHLFSKKQPDLNWENPKVHD
EVHKMMNWWIDRGIGGFRLDVIDLIGKEIDNGITGNGPRLHPLLKQMNNATFGDKDLLTV
GETWDATPEIAKLYSTEDREELSMVFQFEHITLTWTNGDKWKPAPLDLKAFKQVLTKWQL
ELKETGWNSLFWNNHDLPRAVSKYGNDGQYRVKSAKMLATVLHCLKGTPYIYQGEEIGMT
NVKFDNLEQYKDIETLNFYKVRTEAGVSHEEMMAALAENSRDNARTPMQWSNEANAGFST
AEPWIEVNPNYTAVNAKLDRASNESIYEYYKALIGLRREFEAVVYGDFIPLLEEHDKVFA
YLRQHGEQTLLVVANFSDESVDVDLGIEAPTQCTELLSNASIDFSDFSCLTLKPYDAAVL
RL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggaaaaaagatggtggcataactccgttgtctatcagatttacccgcgcagcttctgt
gactccaacggtgatggaattggagatctaaacggtattcgttccaaactagactatcta
actgaactaggtgtggatgtgatttggttatcgcctgtctatcaatctccaatggacgat
aatggttatgatatttcagactatcaagcaatcgcacccgagttcggcacaatggaagac
atggatgccttactagcggaagccaaagaaaggggcatcaaaatcgtcatggatttggta
gtcaatcatacctctgacgagcacgaatggtttaaacgcgcttgcgagtcgaaaacctcg
ccttatcgagattattatgtttggcgagatgcaaagccggatggcagtgcaccgagtgac
atgggctcaatctttggtgggagtgcttgggagtggcacgaggccacgcagcagtattac
ttacatttgttctcgaaaaaacagccggatttaaactgggaaaaccctaaagtacatgat
gaagttcataaaatgatgaactggtggatcgatagggggattggtggtttccgattagat
gtcattgatttgattggcaaagaaattgataacggtattacgggtaatggaccacgccta
caccctctacttaaacagatgaacaatgccacatttggtgacaaagatttgctaacggta
ggagaaacttgggacgcaacgcctgaaatcgccaagctttacagcacggaagaccgcgaa
gagctatcgatggtgttccagtttgaacatattaccttgacctggacgaatggtgacaag
tggaagcctgcgccgttagacctaaaggcattcaaacaggttctgactaagtggcaattg
gagcttaaagagaccgggtggaattcgctgttttggaataatcatgatttaccacgagcg
gtgtctaagtatggaaacgacggccagtatcgagtgaaatcggccaaaatgttagcgaca
gtattacattgcttaaagggcacgccttacatctatcaaggcgaagagattggtatgacg
aatgtgaagttcgacaatcttgagcaatataaagatattgaaacgctcaacttttacaag
gtaagaaccgaagccggtgtgagtcatgaagagatgatggcggcgttggctgaaaacagt
cgcgacaatgctcgtacaccgatgcaatggtcaaatgaagccaacgcaggattctctact
gccgaaccttggatcgaggtcaatccgaactacacagccgtgaatgctaagcttgataga
gcctcgaacgaatcaatctatgagtattacaaagcacttattggtcttcgtcgtgagttt
gaggcggtggtttacggcgactttattcctttactcgaagaacatgacaaggtattcgct
tacctacgtcaacatggagagcaaaccttacttgtggttgcaaactttagtgatgagagt
gttgatgtcgatttaggcattgaggctcctactcaatgtacagagttattgtcaaacgca
agcattgatttctcagattttagttgccttactttaaaaccttatgatgcagcagtactg
cgtctatag

DBGET integrated database retrieval system