KEGG   Vibrio mediterranei: BSZ05_21880Help
Entry
BSZ05_21880       CDS       T04936                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
vsh  Vibrio mediterranei
Pathway
vsh00260  Glycine, serine and threonine metabolism
vsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSZ05_21880
Enzymes [BR:vsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BSZ05_21880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Pyr_redox_3 Pyr_redox_2 FAD_oxidored FAD_binding_2 Methyltransf_25 FMN_dh 2-Hacid_dh_C MTS Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASI92453
UniProt: A0A241TBZ0
LinkDB All DBs
Position
2:1152462..1153493
Genome map
AA seq 343 aa AA seqDB search
MKIKALSKLKPEQGIWMTEVDKPELGHNDILIRIKKTAICGTDVHIYNWDEWSQNTIPVP
MVVGHEYVGEVVGIGQEVRGFEIGDRVSGEGHITCGHCRNCRGGRTHLCRNTVGVGVNRT
GAFSEYLVIPAFNAFKIPEGISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIM
AAAVAKHVGARHVVITDVNEYRLDLARQMGVTRAVNVAKENLKDVMEELGMTEGFDVGLE
MSGVQAAFSSMLETMNHGGRIALLGIPPSDMGIDWNQVIFKGLVIKGIYGREMFETWYKM
ASLIQSGLDLTPIITHHYKIDDFQEGFDVMRSGQSGKVILDWE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaagcgctatctaagctaaagcctgagcaaggcatttggatgaccgaagtg
gacaagcctgaacttggtcacaacgacattctaattcgcattaagaaaacggcaatttgt
ggtactgatgtacacatctataactgggatgagtggtcacaaaacacgattccggttcct
atggttgtcggtcacgaatatgtaggtgaagtagttggtattggccaagaagttcgtggt
ttcgaaattggcgaccgcgtatctggcgagggccacattacttgcggacactgccgtaac
tgccgtggcggtcgtactcacctatgccgcaacacagttggtgttggtgtaaaccgcact
ggtgcgttctctgaatacttggttattccagcgttcaatgcgtttaagatccctgaaggt
atctctgacgatctagcatctatttttgacccgttcggaaacgcagttcacactgcgctg
tcgtttgacctagttggtgaagatgtactgatcacgggcgctggccctatcggcattatg
gccgctgcggttgccaagcacgtaggtgcgcgccacgtagttattactgacgttaacgaa
taccgtctagatcttgcaagacagatgggtgtaacacgtgccgtaaacgttgcaaaagaa
aacctaaaagatgtgatggaagaactaggcatgactgaaggcttcgatgtaggtcttgaa
atgtctggtgttcaagcggcatttagttcaatgcttgaaaccatgaaccacggtggccgt
atcgcactactaggtattccaccatcagacatgggtatagattggaaccaagtgatcttc
aaaggtctggtgatcaaaggtatctacggccgtgaaatgttcgaaacatggtacaagatg
gcaagcttgattcaatctggcttagatctgacgccaattatcactcaccattacaagatt
gatgatttccaagaaggcttcgacgtcatgcgcagcgggcagtctgggaaagttattctc
gattgggaataa

DBGET integrated database retrieval system