KEGG   Vibrio tasmaniensis: VS_0074Help
Entry
VS_0074           CDS       T00812                                 

Definition
(GenBank) Hypothetical ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VS_0074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vsp02000]
    VS_0074
Transporters [BR:vsp02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    VS_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 AAA_16 PRK RsgA_GTPase AAA TniB AAA_23 Mg_chelatase APS_kinase MMR_HSR1 DUF87 AAA_5 MeaB G-alpha
Motif
Other DBs
NCBI-ProteinID: CAV17109
UniProt: B7VH97
LinkDB All DBs
Position
1:62702..64429
Genome map
AA seq 575 aa AA seqDB search
MSLLEVKNLRIEYPSRHGVHAAVKSLSFNIERGEIVGVVGESGAGKSTVGNAVIDLLSPP
GRIASGEVFLDGEKVSGLSPEQMRSVRGSKIGFIFQDPMTSLNPLFTVEQQLKETIYANM
KVSDQEAYQRSLDLMNQVGIPQPENRLKQYPHQFSGGMRQRVVIAIALAGEPDLIIADEP
TTALDVSIQDQILGLIRDLCIKKNVGCMLVTHDMGVVSNVTDRVAVMYRGDLVEFGPTAK
VLGTPEHPYTHSLISAVPRSDRKLDRFPLVSYIEEAHEMEPLDVKNHWLGQSQDHRDYTG
PLLNVENVNLRFTTKDSFFESRREYVQASNNVSFEVHEGETFGLVGESGSGKSTIARVIA
GLYAPNSGKVTFEGVDLTGLKSEKERRPMRRQMQMVFQNPYTSMNPRMKIFDIIAEPIRF
HKLTRNENETRQIVNDLLEHVGLGKMAGVKYPHEFSGGQRQRISIARALATRPRLLICDE
PTSALDVSVQAQILNLLKDLQDELNLTMLFISHDLPVIRQMCDRVGVMQMGELLEVAPTE
QLFQSPQHEYSKHLISLMPEFTGLREEKAVAQAAV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttttagaagtaaaaaatcttcgtatcgaatacccatctcgtcatggagttcac
gccgcagtgaaatcactttcgttcaacattgaacgtggtgagattgttggcgttgtaggc
gagtctggtgcaggcaaatcaacagtaggtaatgctgtgatcgatttgctgagccctcct
ggtcgcattgctagcggcgaggtatttctggacggtgaaaaagtttcaggcttatctcct
gaacagatgcgttctgttcgcggctcaaagattggttttatcttccaagatccaatgact
tctcttaaccctctattcacagtagaacagcagttaaaagagacgatttatgccaacatg
aaggtttcggatcaagaagcctaccagcgctcattagatttgatgaaccaagttggtatt
ccgcaaccagaaaaccgtttaaagcagtacccacaccaattctctggcggtatgcgtcag
cgtgttgttatcgcgatcgcactggcaggtgaacctgacctaatcatcgccgatgaacca
acaaccgcactggatgtttctattcaagaccagatcttgggtttgattcgcgacctatgt
attaagaagaatgtaggttgtatgttggtcacacacgatatgggtgtggtatctaatgtt
accgatcgcgtagccgttatgtatcgtggtgatttggttgagtttggtccgacggcgaaa
gtccttggtactcctgaacacccttacacgcacagtcttatctccgcggttccgcgttca
gatcgtaaacttgatcgtttccctcttgtgagctacatcgaagaagcacatgagatggaa
ccacttgatgtgaaaaaccattggttgggtcaaagccaagatcaccgtgattacactggt
ccactgttgaatgttgaaaatgtaaacttacgctttactaccaaggattctttctttgag
agtcgtcgtgagtacgttcaggcgtcaaacaacgtgagctttgaagtacacgaaggtgaa
acttttggtcttgttggtgaatctggttcgggtaaatcaacgattgctcgtgtgattgct
ggtttgtacgcacctaactcaggtaaggtaacgtttgaaggcgttgatcttacgggactt
aaatctgaaaaagaacgtcgcccaatgcgtcgtcaaatgcagatggttttccaaaaccct
tatacatcaatgaaccctcgaatgaagatattcgacatcattgctgagccgatccgattc
cataaactgacgcgtaacgagaatgaaactcgtcagatcgttaacgacctgctagagcac
gttggtttaggcaagatggctggggttaaatacccacacgaattctcaggtggtcaacgt
cagcgtatttctatcgctcgcgccttggcaactcgtccacgtcttttgatttgtgatgaa
cctacctcggcgctggatgtgtcggttcaggctcagatccttaacctattaaaagattta
caagacgagctcaacctaaccatgctgttcatcagtcacgatttaccggttattcgccaa
atgtgtgatcgtgttggtgtgatgcaaatgggagaactattggaagtagcgccaactgag
cagctattccaatcgcctcagcatgaatacagcaaacacctaatttctttaatgcctgaa
tttacaggtttaagagaagaaaaagcagtggcacaagccgcggtataa

DBGET integrated database retrieval system