KEGG   Vibrio tasmaniensis: VS_0961Help
Entry
VS_0961           CDS       T00812                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vsp  Vibrio tasmaniensis
Brite
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VS_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAV17981
UniProt: B7VLS2
LinkDB All DBs
Position
1:complement(992228..992812)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIVKTS
TGGVFNNAAQIWNHTFYWHCLAPKAGGEPTGAVAEAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLDIVNTSNAATPLTEEGVTPLLTVDLWEHAYYIDFRNVRPDYMAAFW
NLVNWSFVEENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccggctcttccttacgcgaaagacgcgctagaaccacacatctca
gcagaaacgctagatttccaccacggtaagcaccacaacacttacgttgttaagctaaac
ggtcttatcccaggtactgagtttgaaggcaaaacactagaagaaatcgttaagacttct
actggtggtgttttcaataacgctgctcaaatctggaaccacacgttctactggcactgt
cttgctcctaaagcaggcggcgaaccaacaggcgcggttgcagaagcgatcaacgctgca
ttcggttctttcgaagaattcaaagcgaaattcactgattcagcaatcaacaacttcggt
tcttcttggacttggttagttaagaaagctgacggttctctagacatcgttaacacttct
aacgctgcgactcctctaacagaagaaggtgttactccacttctaactgttgacctatgg
gaacacgcttactacatcgatttccgcaatgttcgccctgactacatggctgcattctgg
aacctagtaaactggtctttcgtagaagagaacctagctaagtaa

DBGET integrated database retrieval system