KEGG   Vibrio tasmaniensis: VS_1026Help
Entry
VS_1026           CDS       T00812                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00061  Fatty acid biosynthesis
vsp00780  Biotin metabolism
vsp01100  Metabolic pathways
vsp01212  Fatty acid metabolism
Module
vsp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VS_1026
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    VS_1026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vsp01004]
    VS_1026
Enzymes [BR:vsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     VS_1026
Lipid biosynthesis proteins [BR:vsp01004]
 Fatty acid synthase
  Component type
   VS_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: CAV18081
UniProt: B7VLY5
LinkDB All DBs
Position
1:1066497..1067741
Genome map
AA seq 414 aa AA seqDB search
MSKRRVVVTGMGMLSPVGNTVESSWKALLAGQSGIVNIDHFDATNFSTRFAGLVKDFNCE
EYMTKKDARKMDLFIQYGVAAGIQALDDSALTITEENAPRVGVAIGSGIGGLGLIEAGHK
ALTEKGPRKISPFFVPSTIVNMIAGHMSIMRGLRGPNIAISTACTTGLHNIGHAARMIAY
GDADAMLAGGAEKASTPLGMGGFGAAKALSTRNDEPQKASRPWDKGRDGFVLGDGAGMMV
LEEYEHAKARGAKIYCELVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGITGEQIGY
VNAHGTSTPAGDVAEVKGIKRALGEAGSKQVLVSSTKSMTGHLLGAAGSAEAIITAMSLI
DQIVPPTINLDDPEEGLDIDLVPHTARKVSGMEYAACNSFGFGGTNGCLIFKKI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaagcgtcgtgtagttgtcactggcatgggtatgttgtcgccggtaggcaacact
gtagaatcttcttggaaagccctgctagctggtcaaagtggtatcgttaatatcgatcat
tttgacgcaaccaatttctcaactcgttttgcaggtctagttaaagactttaactgcgaa
gagtatatgactaaaaaagatgctcgtaagatggacttgttcatccagtacggcgtcgca
gcaggtattcaagctttagatgattcagccctaactattactgaagaaaacgctcctcgt
gtaggcgttgctatcggttctggtattggtggtcttggtttgatcgaagccggtcacaag
gctctaactgaaaaaggccctcgtaaaatcagcccgttcttcgtaccgtcgacgatcgtg
aatatgattgcgggtcacatgtctatcatgcgtggcctacgcggtccaaacatcgcgatc
tctacagcatgtacgactggcctacataacattggccacgcggctcgtatgattgcatac
ggcgatgctgacgcaatgctagcgggtggtgctgaaaaagcatcgacaccactaggtatg
ggcggttttggtgcggctaaagcactgtctactcgtaacgatgagcctcaaaaagcttct
cgtccatgggacaaaggccgtgacggcttcgttcttggtgacggtgcaggcatgatggtt
cttgaagagtatgaacatgctaaagctcgtggcgctaagatttactgtgagctagttggc
ttcggtatgtcgggtgacgcttaccacatgacatctccaagtgaagatggttctggtggc
gcactagcaatggaagcggctatgcgtgatgctggcattactggtgaacaaatcggttat
gttaacgcacacggtacttcgactcctgcaggtgacgtagcggaagtgaagggcatcaag
cgtgctcttggcgaagcaggcagcaagcaggtcttggtttcttctacgaaatcaatgact
ggccaccttctaggtgctgcgggttctgctgaagcgatcatcactgcgatgtctctaatt
gatcaaattgttccaccaacaatcaatttagatgatcctgaagaaggcttagatattgac
ttagtacctcacactgcgcgtaaagttagcggtatggaatatgctgcatgtaactcattc
ggtttcggtggtactaacggctgtttgatcttcaaaaagatttaa

DBGET integrated database retrieval system