KEGG   Vibrio tasmaniensis: VS_1338
Entry
VS_1338           CDS       T00812                                 

Definition
(GenBank) Hypothetical protein
Organism
vsp  Vibrio tasmaniensis
SSDB
Motif
Pfam: Phage_GPD PHB_acc_N
Other DBs
NCBI-ProteinID: CAV18488
UniProt: B7VNC5
LinkDB
Position
1:complement(1445092..1445691)
AA seq 199 aa
MTDNFSPSASAIVAKDSKSNEHAVSDFAISEYLSKPFKIELTLISKNFSIDDQLGQKLSI
TRFINDTNNQAATRVFNGIVTQVQLLGMDSNLQYSSYRITLRPWFWLLIHTHSFRVYQNQ
STKDIVSDVLTQAGFSGSFKAGTMPSSKREYCVQYDESDFDFVTRLLAEEGVHYFFQRSY
FPTQRLRSRDDATGRSEPL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgacggataatttctccccttctgccagtgcgattgtggcaaaagattctaaaagcaat
gagcatgcagtcagcgattttgctatttctgagtacctgtcgaagccttttaaaatcgaa
ctaacactcatctcaaaaaacttttcaattgatgaccagcttggtcaaaagctttcgatt
acacgctttattaacgacactaacaaccaagcagccacgcgtgtattcaacggcattgtt
acgcaagttcagttattgggcatggacagtaacctgcagtattctagttatcgcatcact
ctaaggccatggttttggttattgatacacactcattctttccgtgtttatcaaaaccaa
tcgactaaagatatcgtttcagatgtgttaacccaagcaggtttcagtggctcatttaag
gctggtaccatgccctcatccaaacgagagtattgcgttcaatatgatgaaagcgacttt
gatttcgtaactcgcctgcttgctgaagaaggggttcattactttttccaacgttcatat
tttccaacacagcgactcagatcacgtgatgatgctacaggacgctcagagcccttataa

DBGET integrated database retrieval system