KEGG   Vibrio tasmaniensis: VS_2127Help
Entry
VS_2127           CDS       T00812                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vsp  Vibrio tasmaniensis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VS_2127
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VS_2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Glutaredoxin NAD_binding_8 FAD_binding_3 Thi4 AlaDh_PNT_C Lycopene_cycl Thioredoxin_9 Thioredoxin_4 Phage_TTP_13 K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: CAV19302
UniProt: B7VHT2
LinkDB All DBs
Position
1:2286632..2288224
Genome map
AA seq 530 aa AA seqDB search
MLDQAMKQQLKAYLENLKTNVQLVLSLDGSDTANKLQDLANDIASLTDKIEVIRDDNAST
RRPIMQVVNQSKGTAIGFAGLPMGHEFTSLVLALLHSGGHPIKLEADVIEQIKELDQELN
VEIFISLSCQNCPEVVQAFNMMSAINPLVKTTMIDGAAFQDEVKSRDIMAVPSVFINGEL
FGQGRMSLAEILNKVDSGAAEKKAANLNQQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
VADRFGGQVMDTMAIENFISVKATTGPKLVASLEEHVKEYGVEVMTEQRAANIIAAENTE
DGYIHVELESGATLRARTVITSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLIDKANATPNIEIIKMAQTTQVIG
DGNRVTGLEYKDRNTDELKQIELAGIFVQIGLMPNSEWLKGSKVELSPRGEIEINAHGAT
SMKGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRNSAPVKEAETA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagcaatgaagcagcagctaaaagcatacctagaaaacctaaaaaccaat
gttcagttagtccttagcctggatggcagcgacaccgcgaacaaacttcaagatctggcg
aatgatatagcttctctcactgacaaaattgaagtgattcgagatgataacgcaagcact
cgccgcccaatcatgcaggtcgtgaaccaatcgaaaggcactgcgatcggtttcgccggt
ttacctatgggtcacgaattcacgtcactggttctagcactgctccatagtggtggtcac
cctatcaagcttgaagcggacgtaatcgagcaaattaaagaactcgatcaagagcttaat
gtagagatttttatctcactatcgtgccaaaactgtccagaagtggttcaggcgttcaac
atgatgtcggcgattaaccctctagttaagacaacgatgattgatggcgcagcattccaa
gacgaagtgaagtctcgcgacatcatggcagtaccaagcgtgtttattaacggtgagcta
tttggtcaaggccgtatgtcactggctgaaatccttaacaaagtcgattcaggcgcagca
gaaaagaaagcagcaaacctaaaccaacaagcaccgtttgatgtattggttgtcggtggt
ggccctgcgggttcttcagccgctatctatgcggcacgtaaaggcattcgtaccggtgtg
gttgctgaccgattcggtggtcaagtgatggatacgatggcgattgagaactttatctca
gtgaaagcgacaactggccctaagttagtggccagccttgaagagcacgtaaaagagtac
ggtgttgaagtgatgactgagcagcgcgctgcaaacatcattgcggcagaaaacactgaa
gacggttacatccacgtagagctagagagcggcgcaacactacgagctcgcacggttatc
acaagtaccggtgctcgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaat
aaaggtgtagcttactgcccacactgtgacggtcctttattcaaaggtaagaaaacagcg
gttatcggtggtggtaactcaggcatcgaagcggcaattgatttagcgggtatcgttgaa
cacgtaaccgtacttgaatttgcagacacactgcgtgccgaccaagtgcttatcgacaaa
gcgaacgcaacaccaaacatcgaaatcatcaagatggcgcaaacaacgcaagtgattggt
gatggcaaccgcgtaaccggtctggaatacaaagaccgcaacaccgatgaacttaaacag
attgaactagcaggtatctttgttcaaatcggcctgatgccaaacagcgaatggttgaag
ggttcgaaggtagagctttcaccacgcggtgaaattgaaattaacgctcatggcgcaaca
tcaatgaaaggtgtattcgcagcgggtgacgtaacaaccgtaccttacaaacagatcatc
attgcaatgggtgaaggtgcaaaagcaagcttaggtgcatttgaccacctaatccgtaac
tcagctccagttaaagaggctgaaaccgcttaa

DBGET integrated database retrieval system